Property Summary

NCBI Gene PubMed Count 89
Grant Count 1
Funding $51,478.1
PubMed Score 23.85
PubTator Score 41.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.222 0.005
Multiple myeloma 1.884 0.005
psoriasis 1.900 0.000
astrocytoma 1.400 0.000
glioblastoma 2.300 0.000
oligodendroglioma 1.100 0.000
osteosarcoma 1.442 0.001
posterior fossa group A ependymoma 1.700 0.000
group 3 medulloblastoma 2.000 0.000
atypical teratoid/rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.200 0.001
Duchenne muscular dystrophy 1.324 0.000
juvenile dermatomyositis 1.468 0.000
acute quadriplegic myopathy 1.154 0.000
diabetes mellitus -1.100 0.013
Breast cancer 2.200 0.044
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.200 0.000
ovarian cancer 1.700 0.004
dermatomyositis 1.300 0.003

Synonym

Accession P08754 P17539 Q5TZX1
Symbols 87U6
ARCND1

Gene

 Grant Application (1)

PDB

2V4Z   2IHB   2ODE   4G5O   4G5R   4G5S  

 GWAS Trait (1)

Gene RIF (25)

PMID Text
26391662 GIV and its substrate Galphai3 are recruited to active integrin complexes
26213104 In postmortem human prefrontal cortex, adenosine A1 receptor is coupled preferentially, if not exclusively, to Galphai-3.
25977476 transcriptional upregulation of Girdin expression and Girdin-Galphai3 signaling play crucial roles in regulating epithelial apicobasal polarity through the PAR complex.
25444921 Low GNAI3 expression is associated with hepatocellular carcinoma.
25187647 Both SH2 and GEF domains of GIV are required for the formation of a ligand-activated ternary complex between GIV, Galphai3, and EGFR.
25078664 We observed increased expression of Galphai1/3 in wounded human skin and keloid skin tissues, suggesting the possible involvement of Galphai1/3 in wound healing and keloid formation.
25026904 We demonstrate that the GNAI3 variant is the likely cause of auriculocondylar syndrome in the original ACS1 family.
24415754 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
23389635 Data indicate that dynein- and astral microtubule-mediated transport of Galphai/LGN/nuclear mitotic apparatus (NuMA) complex from cell cortex to spindle poles.
22560091 The phenotypic variability of auriculocondylar syndrome suggests that mutations in this pathway, especially those affecting core signaling molecules such as PLCB4 and GNAI3, should be considered as potential candidates for other ear and jaw malformations.
More...

AA Sequence

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYK      1 - 70
VVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACF     71 - 140
SRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKK    141 - 210
WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKR    211 - 280
SPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKE    281 - 350
CGLY                                                                      351 - 354
//

Text Mined References (97)

PMID Year Title
26391662 2015 Integrins activate trimeric G proteins via the nonreceptor protein GIV/Girdin.
26213104 2015 Adenosine A1( )receptors are selectively coupled to G?(i-3) in postmortem human brain cortex: Guanosine-5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTP?S) binding/immunoprecipitation study.
25977476 2015 Regulation of epithelial cell polarity by PAR-3 depends on Girdin transcription and Girdin-G?i3 signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25444921 2015 GNAI3 inhibits tumor cell migration and invasion and is post-transcriptionally regulated by miR-222 in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25187647 2014 Structural basis for activation of trimeric Gi proteins by multiple growth factor receptors via GIV/Girdin.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
25026904 2015 Novel variants in GNAI3 associated with auriculocondylar syndrome strengthen a common dominant negative effect.
More...