Property Summary

NCBI Gene PubMed Count 97
PubMed Score 1370.19
PubTator Score 937.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (17)

Disease log2 FC p
Endometriosis -1.295 1.5e-02
active ulcerative colitis 2.055 3.7e-02
Breast cancer -1.300 1.2e-02
cystic fibrosis 1.198 5.2e-05
ductal carcinoma in situ 2.900 1.2e-02
interstitial cystitis -3.100 1.7e-02
lung cancer -2.300 3.7e-05
lung carcinoma -2.900 4.0e-29
malignant mesothelioma -5.700 8.2e-10
nasopharyngeal carcinoma -2.000 8.0e-04
non-small cell lung cancer -1.632 8.8e-06
ovarian cancer 3.000 4.4e-04
pancreatic cancer 3.000 6.2e-07
pancreatic ductal adenocarcinoma liver m... 3.826 1.0e-02
pituitary cancer -1.800 1.2e-02
psoriasis -2.000 1.7e-05
X-linked cerebral adrenoleukodystrophy 2.800 2.4e-02

Gene RIF (74)

AA Sequence

MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQ      1 - 70
SLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDI     71 - 140
FEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVE    141 - 210
LEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAE    211 - 280
AWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA    281 - 350
RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG    351 - 420
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD                         421 - 469
//

Text Mined References (107)

PMID Year Title