Property Summary

NCBI Gene PubMed Count 88
Grant Count 2
Funding $50,413.88
PubMed Score 1303.76
PubTator Score 937.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -5.700 0.000
psoriasis -2.000 0.000
cystic fibrosis 1.198 0.000
pancreatic ductal adenocarcinoma liver m... 3.826 0.010
non-small cell lung cancer -1.632 0.000
X-linked cerebral adrenoleukodystrophy 2.800 0.024
lung cancer -2.300 0.000
active ulcerative colitis 2.055 0.037
pancreatic cancer 3.000 0.000
interstitial cystitis -3.100 0.017
nasopharyngeal carcinoma -2.000 0.001
Endometriosis -1.295 0.015
lung carcinoma -2.900 0.000
Breast cancer -1.300 0.012
ductal carcinoma in situ 2.900 0.012
ovarian cancer 3.000 0.000
pituitary cancer -1.800 0.012

Synonym

Accession P08729 Q92676 Q9BUD8 Q9Y3R7
Symbols K7
CK7
SCL
K2C7

Gene

 Grant Application (2)

PDB

4XIF  

 GO Process (1)

Gene RIF (65)

PMID Text
26670478 K7 expression was also detected in 72 of 75 triple-negative carcinoma cases
26551618 Cytokeratin 7 positivity in cervical low-grade squamous intraepithelial lesion is a marker for risk of progression to a high-grade lesion.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26366614 Immunostaining for CK7 and epithelial membrane antigen can be used to differentiate interlobular bile ducts from ductular proliferation in patients with cholestasis.
26306784 Data show that cytokeratin-7 (KRT7) mRNA expression serves as a sensitive approach for the molecular detection of KRT7-positive circulating tumour cells (CTCs)-resembling A549 cells in peripheral whole blood.
25643514 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder.
25406900 Epithelial-mesenchymal transition-related proteins CK-7 and alpha-SMA colocalized to the intrahepatic biliary epithelial cells in patients with biliary atresia.
25076852 The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests
25063315 There were differences between CK5/6, p63,CK34betaE12 and TTF-1 expression with tumor differentiation in squamous cell carcinoma or adenocarcinomas
24908142 BRAF-mutated microsatellite stable colorectal carcinoma often displays reduced CDX2 and increased CK7 expression
More...

AA Sequence

MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQ      1 - 70
SLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDI     71 - 140
FEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVE    141 - 210
LEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAE    211 - 280
AWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA    281 - 350
RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG    351 - 420
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD                         421 - 469
//

Text Mined References (97)

PMID Year Title
26670478 2016 Aberrant keratin 7 and 20 expression in triple-negative carcinoma of the breast.
26551618 2016 Predictive Value of Cytokeratin 7 Immunohistochemistry in Cervical Low-grade Squamous Intraepithelial Lesion as a Marker for Risk of Progression to a High-grade Lesion.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26366614 Identification of Bile Duct Paucity in Alagille Syndrome: Using CK7 and EMA Immunohistochemistry as a Reliable Panel for Accurate Diagnosis.
26306784 2015 Prognostic value of cytokeratin-7 mRNA expression in peripheral whole blood of advanced lung adenocarcinoma patients.
25643514 2014 Expression of cytokeratin 7, 20, 14 in urothelial carcinoma and squamous cell carcinoma of the Egyprian urinary bladder cancer.
25406900 2015 The expression of epithelial-mesenchymal transition-related proteins in biliary epithelial cells is associated with liver fibrosis in biliary atresia.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25076852 2014 Wnt signaling as a possible promoting factor of cell differentiation in pleomorphic adenomas.
More...