Property Summary

NCBI Gene PubMed Count 189
Grant Count 63
R01 Count 28
Funding $6,025,760.14
PubMed Score 1556.57
PubTator Score 1381.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Synonym

Accession P08727 B2R874 Q5XG83 Q6NW33 Q7L5M9 Q96A53 Q96FV1 Q9BYF9 Q9P1Y4
Symbols K19
CK19
K1CS

Gene

Gene RIF (158)

PMID Text
27141570 CK19 staining was found in hepatic hydatidosis patients with and without biliary fistula.
26977595 CK19 expression was measured in hepatocellular carcinoma at different stages and correlated with prognosis. CK19+/GPC3+ HCC has the highest risk of intrahepatic metastasis, microvascular invasion, regional lymph node involvement, and distant metastasis.
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26657594 We report results of the studies relating to fabrication of a non-invasive, label-free and an efficient biosensing platform for detection of the oral cancer biomarker (CYFRA-21-1).
26609030 Positive staining for CK19 suggests a possible LPC origin of the EpCAM positive hepatocellular carcinoma .
26588210 When confirmed by a low alpha-fetoprotein concentration (<400 mug/L), CK-19 expression in is an additional valuable indicator of early recurrence, distant metastasis, and poor prognosis in HBV-positive patients
26503236 CK19 and HBME-1 were significantly expressed more in papillary carcinoma as compared to follicular carcinoma
26408719 High CYFRA 21-1 serum levels are associated with Head and Neck Cancer.
26333429 Serum CYFRA21-1 and CEA can be used as prognostic factors of NSCLC patients. Combinative detection of the two indices will be more reliable.
26292957 High serum levels of CYFRA 21-1 are associated with oral squamous cell carcinoma.
More...

AA Sequence

MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLT      1 - 70
ASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDK     71 - 140
ILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDLEMQIEGLKEE    141 - 210
LAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNR    211 - 280
EVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLG    281 - 350
DVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL                        351 - 400
//

Text Mined References (196)

PMID Year Title
27141570 Histopathological Aspects Described in Patients with Hepatic Hydatidosis.
26977595 2016 CK19 and Glypican 3 Expression Profiling in the Prognostic Indication for Patients with HCC after Surgical Resection.
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26657594 2016 Nanostructured zirconia decorated reduced graphene oxide based efficient biosensing platform for non-invasive oral cancer detection.
26609030 2015 Cancer stem cells in hepatocellular carcinoma--an immunohistochemical study with histopathological association.
26588210 2015 Use of Cytokeratin-19 Concentration to Assess Early Recurrence and Prognosis of Hepatitis B Virus-Related Hepatocellular Carcinoma following Radical Resection in Patients with a Low Serum Alpha-Fetoprotein Concentration.
26503236 2015 Defining the value of CD56, CK19, Galectin 3 and HBME-1 in diagnosis of follicular cell derived lesions of thyroid with systematic review of literature.
26408719 2015 The Diagnostic and Prognostic Value of Tumor Markers (CEA, SCC, CYFRA 21-1, TPS) in Head and Neck Cancer Patients.
26333429 2015 Prognostic value of serum CYFRA21-1 and CEA for non-small-cell lung cancer.
26292957 2015 Serum markers of CYFRA 21-1 and C-reactive proteins in oral squamous cell carcinoma.
More...