Property Summary

Ligand Count 264
NCBI Gene PubMed Count 425
PubMed Score 3424.86
PubTator Score 338.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Vascular disease 319 0.0 3.0
Disease Target Count
Hemorrhagic disease 3

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 7.3e-05
atypical teratoid / rhabdoid tumor -1.300 2.4e-06
glioblastoma -1.400 1.3e-06
group 4 medulloblastoma -1.100 1.8e-04
malignant mesothelioma 1.900 1.9e-04
medulloblastoma, large-cell -1.200 1.0e-05
pancreatic ductal adenocarcinoma liver m... -1.873 4.0e-02

Synonym

Accession P08709 B0YJC8 Q14339 Q5JVF1 Q5JVF2 Q9UD52 Q9UD53 Q9UD54
Symbols SPCA

Gene

F7

PANTHER Protein Class (3)

PDB

5L0S   1DAN   1FAK   1J9C   1NL8   1O5D   1W0Y   1W2K   1WQV   1WSS   1WTG   1WUN   1WV7   1Z6J   2A2Q   2AEI   2AER   2B7D   2B8O   2C4F   2EC9   2F9B   2FIR   2FLB   2FLR   2PUQ   2ZP0   2ZWL   2ZZU   3ELA   3TH2   3TH3   3TH4   4IBL   4YLQ   4Z6A   4ZMA   1BF9   1CVW   1DVA   1F7E   1F7M   1FF7   1FFM   1JBU   1KLI   1KLJ   1QFK   1W7X   1W8B   1YGC   2BZ6   4ISH   4ISI   4JYU   4JYV   4JZD   4JZE   4JZF   4NA9   4NG9   4NGA   4X8S   4X8T   4X8U   4X8V   4YT6   4YT7   4ZXX   4ZXY   5I46   5L2Y   5L2Z   5L30   5PA8   5PA9   5PAA   5PAB   5PAC   5PAE   5PAF   5PAG   5PAI   5PAJ   5PAK   5PAM   5PAN   5PAO   5PAQ   5PAR   5PAS   5PAT   5PAU   5PAV   5PAW   5PAX   5PAY   5PB0   5PB1   5PB2   5PB3   5PB4   5PB5   5PB6   5TQE   5TQF   5TQG   5U6J  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (3)

Gene RIF (390)

AA Sequence

MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRP      1 - 70
GSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRN     71 - 140
CETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQ    141 - 210
GRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDE    211 - 280
QSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDR    281 - 350
GATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTG    351 - 420
IVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP                            421 - 466
//

Text Mined References (435)

PMID Year Title