Property Summary

NCBI Gene PubMed Count 413
Grant Count 170
R01 Count 77
Funding $23,180,004.19
PubMed Score 3363.68
PubTator Score 338.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P08709 B0YJC8 Q14339 Q5JVF1 Q5JVF2 Q9UD52 Q9UD53 Q9UD54
Symbols SPCA

Gene

F7

PDB

1DAN   1FAK   1J9C   1NL8   1O5D   1W0Y   1W2K   1WQV   1WSS   1WTG   1WUN   1WV7   1Z6J   2A2Q   2AEI   2AER   2B7D   2B8O   2C4F   2EC9   2F9B   2FIR   2FLB   2FLR   2PUQ   2ZP0   2ZWL   2ZZU   3ELA   3TH2   3TH3   3TH4   4IBL   4YLQ   4Z6A   4ZMA   1BF9   1CVW   1DVA   1F7E   1F7M   1FF7   1FFM   1JBU   1KLI   1KLJ   1QFK   1W7X   1W8B   1YGC   2BZ6   4ISH   4ISI   4JYU   4JYV   4JZD   4JZE   4JZF   4NA9   4NG9   4NGA   4X8S   4X8T   4X8U   4X8V   4YT6   4YT7   4ZXX   4ZXY   5I46  

Gene RIF (379)

PMID Text
27215039 Holders of the R allele had significantly higher activity of coagulation factor F7 (97.66 +/- 15.48 against 83.37 +/- 15.16, p = 0.002) and factor F2 (107.45 +/- 6.03 against 103.75 +/- 6.81, p = 0.023) than holders of the Q allele
26694616 Data suggest that allosteric regulation of FVIIa activity by tissue factor/thromboplastin binding appear to involve direct interaction with FVIIa active site, stabilizing segment 215-217, activating loop 3, and leading to enhanced FVIIa activity.
26408924 Structure-Function Relationship of the Interaction between Tissue Factor and Factor VIIa.
26169722 results suggest that these TF residues interact with the GLA domain of FX in a Mg(2+)-dependent manner (although effects of Mg(2+) on the FVIIa GLA domain cannot be ruled out).
25973586 The story of FVII well summarizes the efforts of both theoretical and clinical approaches in the characterization of a coagulation disorder, that is, among the rare bleeding conditions, most frequently encountered in clinical practice.
25891834 Decreased plasma levels of FVIIa in patients with deep vein thrombosis may indicate ongoing consumption of FVIIa and suggest a contributory role for TF in venous thrombus formation.
25863091 Two heterozygous mutations of F7, g.11349G>A and g.11482T>G, is associated with hereditary coagulation factor deficiency.
25828579 The aim of the study was to evaluate the molecular basis behind low levels of FVII activity (FVII:C) levels in a cohort of Brazilian patients.
25767893 Identified are the FVII gene mutations in the Chinese Han population of four unrelated FVII-deficient patients, and the effect of these mutations on the function of FVII molecule level has also been elucidated.
25447311 High Coagulation factor VII expression is associated with breast cancer.
More...

AA Sequence

MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRP      1 - 70
GSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRN     71 - 140
CETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQ    141 - 210
GRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDE    211 - 280
QSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDR    281 - 350
GATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTG    351 - 420
IVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP                            421 - 466
//

Text Mined References (423)

PMID Year Title
27215039 2016 [Polymorphism (353)R>Q of Gene of Blood Clotting Factor FVII and Plasma Hemostasis].
26761581 2016 Severe coagulation factor VII deficiency caused by a novel homozygous mutation (p. Trp284Gly) in loop 140s.
26694616 2016 Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
26408924 2015 Structure-Function Relationship of the Interaction between Tissue Factor and Factor VIIa.
26169722 2015 Tissue Factor Residues That Modulate Magnesium-Dependent Rate Enhancements of the Tissue Factor/Factor VIIa Complex.
25973586 2015 The Story of Serum Prothrombin Conversion Accelerator, Proconvertin, Stable Factor, Cothromboplastin, Prothrombin Accelerator or Autoprothrombin I, and Their Subsequent Merging into Factor VII.
25891834 2015 Decreased plasma levels of activated factor VII in patients with deep vein thrombosis.
25863091 2015 [Genetic analysis of a pedigree with hereditary coagulation factor ? deficiency].
25828579 2015 The molecular basis of low activity levels of coagulation factor VII: a Brazilian cohort.
25767893 2015 Phenotypic and genotypic characterization of four factor VII deficiency patients from central China.
More...