Property Summary

NCBI Gene PubMed Count 133
PubMed Score 2101.52
PubTator Score 1765.38

Knowledge Summary

Patent

No data available

Gene RIF (111)

AA Sequence

MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMEN      1 - 70
NLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENA     71 - 140
QAQQTTLSLAIF                                                              141 - 152
//

Text Mined References (133)

PMID Year Title