Property Summary

NCBI Gene PubMed Count 126
Grant Count 518
R01 Count 312
Funding $38,672,543.28
PubMed Score 2107.28
PubTator Score 1765.38

Knowledge Summary

Patent

No data available

Synonym

Accession P08700 Q6GS87 IL-3
Symbols IL-3
MCGF
MULTI-CSF

Gene

IL3

PDB

1JLI  

Gene RIF (104)

PMID Text
26875095 results suggest that IL3 is an important genetic regulator for human brain volume variation and implied that IL3 might have experienced weak or modest positive selection in the evolutionary history of humans
26299549 results suggest that IL-3 and IL-12p40 could be considered as molecular predictors for recurrent wheezing due to RSV infection
26277822 were not able to confirm the association of IL-3 SNPs with schizophrenia.
25962901 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent
25766237 findings showed that high plasma IL-3 levels are associated with high mortality in sepsis
25472883 HIV-1 Tat specifically associates with IL-3 promoter to upregulate IL-3 expression in T cells
24684517 IL3 SNP rs40401 is significantly associated with the risk of asthma in young adult Japanese women.
24670917 Genetic variation in interleukin-3 gene is associated with breast cancer risk.
24658545 results suggest that HuR recognizes the ARE-rich region in the IL-3 3'-UTR and plays a role in the IL-3 3'-UTR-mediated post-transcriptional control in T-cells
24598054 This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML.
More...

AA Sequence

MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMEN      1 - 70
NLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENA     71 - 140
QAQQTTLSLAIF                                                              141 - 152
//

Text Mined References (126)

PMID Year Title
26875095 2016 Adaptive evolution of interleukin-3 (IL3), a gene associated with brain volume variation in general human populations.
26299549 2015 Elevated IL-3 and IL-12p40 levels in the lower airway of infants with RSV-induced bronchiolitis correlate with recurrent wheezing.
26277822 2015 Association of interleukin 3 (IL-3) polymorphisms with schizophrenia in Han Chinese population.
25962901 2015 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent.
25766237 2015 Interleukin-3 amplifies acute inflammation and is a potential therapeutic target in sepsis.
24684517 2014 IL3 rs40401 polymorphism and interaction with smoking in risk of asthma in Japanese women: the Kyushu Okinawa Maternal and Child Health study.
24670917 2014 Genetic variants in interleukin genes are associated with breast cancer risk and survival in a genetically admixed population: the Breast Cancer Health Disparities Study.
24658545 2014 The role of HuR in the post-transcriptional regulation of interleukin-3 in T cells.
24598054 2014 Interleukin-3-mediated regulation of ?-catenin in myeloid transformation and acute myeloid leukemia.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
More...