Property Summary

NCBI Gene PubMed Count 91
Grant Count 123
R01 Count 67
Funding $11,335,122.35
PubMed Score 1523.49
PubTator Score 787.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.586 0.015

Synonym

Accession P08697 B4E1B7 Q8N5U7 Q9UCG2 Q9UCG3 Alpha-2-AP
Symbols AAP
API
PLI
A2AP
ALPHA-2-PI

Gene

Gene RIF (36)

PMID Text
26743600 alpha2AP has a profibrotic effect probably not by the action as a plasmin inhibitor, and the blocking of alpha2AP exerts an antifibrotic effect in humans and mice with systemic sclerosis
26626994 This review presents recent findings regarding the main aspects of the natural heterogeneity of A2AP with particular focus on the functional and possible clinical implications. [review]
26088309 Changes in plasma A2AP are associated with cardiovascular disease event presentation.
25464232 A significant correlation was found between soluble fibroblast activation protein levels and alpha2-antiplasmin cleavage in coronary thrombosis.
25331118 FXIII-A has a functional role through exposure on the activated platelet membrane where it exerts antifibrinolytic function by cross-linking alpha2AP to fibrin
25065555 Possession of the alpha2AP 407Lys allele was negatively associated with AAA, and thus changes in alpha2AP may affect aneurysm growth and development.
24818165 Data suggest serum A2AP (SERPINF2) level can serve as biomarker for diabetic retinopathy; levels of A2AP (but not fibrinogen, plasminogen, or plasminogen activator inhibitor 1) are up-regulated in hyperglycemic type 1 diabetes with retinopathy.
24659849 Two differentially expressed proteins, alpha-1-antitrypsin (SERPINA1) and alpha-2 antiplasmin (SERPINF2) are associated with purpura fulminans.
24034420 increased N-terminal cleavage of alpha2AP may have a role in liver cirrhosis
23992406 protective mediator during gram-negative (pneumo)sepsis, limiting bacterial growth, inflammation, tissue injury, and coagulation
More...

AA Sequence

MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQTALKSPPGVC      1 - 70
SRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGS     71 - 140
GPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPVSLTGKQEDDLANINQWVKE    141 - 210
ATEGKIQEFLSGLPEDTVLLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLL    211 - 280
EQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVAT    281 - 350
LSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF    351 - 420
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSP    421 - 490
K//

Text Mined References (95)

PMID Year Title
26743600 2016 The Antifibrotic Effect of ?2AP Neutralization in Systemic Sclerosis Dermal Fibroblasts and Mouse Models of Systemic Sclerosis.
26626994 2016 Natural heterogeneity of ?2-antiplasmin: functional and clinical consequences.
26088309 2015 High Levels of Antifibrinolytic Proteins Are Found in Plasma of Older Octogenarians With Cardiovascular Disease and Cognitive Decline.
25464232 2015 Plasma levels of soluble fibroblast activation protein in arterial thrombosis: determinants and cleavage of its substrate alpha-2-antiplasmin.
25331118 2014 Functional factor XIII-A is exposed on the stimulated platelet surface.
25065555 2014 The alpha-2-antiplasmin Arg407Lys polymorphism is associated with abdominal aortic aneurysm.
24818165 2014 Evaluation of serum fibrinogen, plasminogen, ?2-anti-plasmin, and plasminogen activator inhibitor levels (PAI) and their correlation with presence of retinopathy in patients with type 1 DM.
24659849 2014 Identification of differentially expressed serum proteins in infectious purpura fulminans.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
More...