Property Summary

NCBI Gene PubMed Count 700
Grant Count 830
R01 Count 407
Funding $117,621,073.11
PubMed Score 4493.97
PubTator Score 4568.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P08684 P05184 Q16757 Q9UK50
Symbols HLP
CP33
CP34
CYP3A
NF-25
CYP3A3
P450C3
CYPIIIA3
CYPIIIA4
P450PCN1

Gene

PANTHER Protein Class (2)

PDB

1TQN   1W0E   1W0F   1W0G   2J0D   2V0M   3NXU   3TJS   3UA1   4D6Z   4D75   4D78   4D7D   4I3Q   4I4G   4I4H   4K9T   4K9U   4K9V   4K9W   4K9X   4NY4   5A1P   5A1R  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
884 confirmatory 3571 / 2927 / 7657 qHTS Assay for Inhibitors and Substrates of Cytochrome P450 3A4
885 confirmatory 168 / 202 / 13715 qHTS Assay for Activators of Cytochrome P450 3A4

Gene RIF (712)

PMID Text
26970587 CYP3A4 further activates, rather than inactivates, 20-hydroxy vitamin D3.
26814638 Data suggest that CYP3A4 present in lipid microdomain/nanodisc exhibits membrane-induced stabilization; this stabilization is enhanced upon addition of ligand/inhibitor ketoconazole; thus, CYP3A4 appears to exhibit distinct orientation in membrane.
26654672 Early postpartum women possessed higher CYP3A activity based on plasma 4beta-hydroxycholesterol and had a large pharmacokinetic variability in amlodipine disposition.
26627649 The shape and localization of human CYP3A4 protein embedded in a phospholipid nanodisc environment has been determined.
26615671 a critical role of the CYP3A5 6986A>G and CYP3A4 -392A>G polymorphisms on the variation of Tac exposure during the early and the late post-transplant phase, respectively.
26521259 Both donor and recipient CYP3A5 genotype significantly influences tacrolimus once daily pharmacokinetics in stable liver transplant recipients, while CYP3A4*22 is not a suitable biomarker
26488616 Data provides evidence that CYP3A4*22 (rs35599367) increases the formation of the nonfunctional CYP3A4 splice variant with partial intron 6 retention, thereby reducing the production of functional full-length CYP3A4 mRNA.
26467767 Report CYP3A4 induction in six fully characterized cryopreserved human hepatocyte preparations and HepaRG cell line.
26366873 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26340669 decreases of CES and CYP3A4 expression and enzymatic activities induced by Fluoxetine are through decreasing PXR and increasing DEC1 in HepG2 cells
More...

AA Sequence

MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGK      1 - 70
VWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSG     71 - 140
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKL    141 - 210
LRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN    211 - 280
SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTV    281 - 350
LQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS    351 - 420
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVV    421 - 490
LKVESRDGTVSGA                                                             491 - 503
//

Text Mined References (710)

PMID Year Title
26970587 2016 Hydroxylation of 20-hydroxyvitamin D3 by human CYP3A4.
26814638 2016 Membrane Interactions, Ligand-Dependent Dynamics, and Stability of Cytochrome P4503A4 in Lipid Nanodiscs.
26654672 2015 CYP3A activity based on plasma 4?-hydroxycholesterol during the early postpartum period has an effect on the plasma disposition of amlodipine.
26627649 2015 Small-angle scattering determination of the shape and localization of human cytochrome P450 embedded in a phospholipid nanodisc environment.
26615671 2015 Influence of combined CYP3A4 and CYP3A5 single-nucleotide polymorphisms on tacrolimus exposure in kidney transplant recipients: a study according to the post-transplant phase.
26521259 2016 Population pharmacokinetics and pharmacogenetics of once daily tacrolimus formulation in stable liver transplant recipients.
26488616 2016 CYP3A4 intronic SNP rs35599367 (CYP3A4*22) alters RNA splicing.
26467767 2016 Evaluation of Normalization Methods To Predict CYP3A4 Induction in Six Fully Characterized Cryopreserved Human Hepatocyte Preparations and HepaRG Cells.
26366873 2015 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26340669 2016 Fluoxetine reduces CES1, CES2, and CYP3A4 expression through decreasing PXR and increasing DEC1 in HepG2 cells.
More...