Property Summary

NCBI Gene PubMed Count 389
PubMed Score 1830.95
PubTator Score 6424.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
CATARACT 30 1
cataract 2 multiple types 9

Expression

  Differential Expression (32)

Protein-protein Interaction (11)

Gene RIF (324)

AA Sequence

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL      1 - 70
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG     71 - 140
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV    141 - 210
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA    211 - 280
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN    281 - 350
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS    351 - 420
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE                            421 - 466
//

Text Mined References (414)

PMID Year Title