Property Summary

NCBI Gene PubMed Count 340
Grant Count 84
R01 Count 39
Funding $20,813,854.37
PubMed Score 1676.88
PubTator Score 6424.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Essential tremor 30 7.447 3.7
Parkinson's disease 364 5.052 2.5
Dystonia 77 4.523 2.3
Cancer 2,346 4.306 2.2
Myoclonic cerebellar dyssynergia 1 3.21 1.6
AMYOTROPHIC LATERAL SCLEROSIS 1 49
Acute coronary syndrome 37
Becker muscular dystrophy 187
Carcinosarcoma 6
Cataract 104 4.0
Degenerative polyarthritis 93
Down syndrome 548
Duchenne muscular dystrophy 602
Mammary Neoplasms 410
Motor neuron disease 39
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
Nephrosis 18
Neurodegenerative Disorders 37
Prostatic Neoplasms 471
Reperfusion Injury 84
Retinal Diseases 21
Synovial sarcoma 25
Weight Gain 87
acute quadriplegic myopathy 1,157
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
cystic fibrosis 1,665
fibroadenoma 557
gastric carcinoma 832
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung cancer 4,466
lung carcinoma 2,844
non primary Sjogren syndrome sicca 840
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P08670 B0YJC2 D3DRU4 Q15867 Q15868 Q15869 Q548L2 Q6LER9 Q8N850 Q96ML2 Q9NTM3
Symbols HEL113
CTRCT30

Gene

VIM

PDB

4MCY   4MCZ   4MD0   4MD5   4MDI   4MDJ   1GK4   1GK6   1GK7   3G1E   3KLT   3S4R   3SSU   3SWK   3TRT   3UF1   4YPC   4YV3  

Gene RIF (285)

PMID Text
27069130 Vimentin Regulates Invasiveness and Is a Poor Prognostic Marker in Non-small Cell Lung Cancer
27048119 TWIST2 regulates epithelial-mesenchymal transition by depriving the epithelial cell phenotype of E-cadherin and endowing the mesenchymal cell phenotype with Vimentin, which may be involved in the progression and prognosis of ovarian cancer.
26708270 The present study therefore indicated that IL-6 promoted the process of EMT in HIBECs as characterized by increased migration and invasion of HIBECs and the typical changes in mRNA and protein expression of the EMT markers E-cadherin and vimentin.
26702618 These data suggest that the number of polyploid giant cancer cells and the EMT-related proteins E-cadherin, N-cadherin, and vimentin may be valuable biomarkers to assess metastasis in patients with breast cancer.
26646105 High vimentin and low beta4 integrin protein levels are associated with poor survival in oral squamous carcinoma patients.
26617803 PTTG2 induces psoriasis by regulating epidermal expression of vimentin and E-cadherin.
26567912 Low aggressive MCF-7 breast cancer cells have low endogenous PLD enzymatic activity and cell invasion, concomitant with high expression of miR-203, -887, and -3619 and miR-182 and miR-182.
26499837 Data show that over-expression of vimentin ameliorated cytotoxicity of gambogic acid (GA) in HeLa cells.
26466680 On the basis of these results, we propose a model in which dynamic vimentin filaments target CARMIL2 to critical membrane-associated locations, where CARMIL2 regulates CP, and thus actin assembly, to create cell protrusions
26180933 immunohistochemical pattern helps to differentiate cystic renal oncocytoma from tubulocystic renal cell carcinoma
More...

AA Sequence

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL      1 - 70
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG     71 - 140
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV    141 - 210
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA    211 - 280
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN    281 - 350
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS    351 - 420
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE                            421 - 466
//

Text Mined References (362)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27069130 2016 Vimentin Regulates Invasiveness and Is a Poor Prognostic Marker in Non-small Cell Lung Cancer.
27048119 2016 Role of TWIST2, E-cadherin and Vimentin in epithelial ovarian carcinogenesis and prognosis and their interaction in cancer progression.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26708270 2016 Interleukin?6 induces epithelial?mesenchymal transition in human intrahepatic biliary epithelial cells.
26702618 2015 The number of polyploid giant cancer cells and epithelial-mesenchymal transition-related proteins are associated with invasion and metastasis in human breast cancer.
26646105 2016 Vimentin-mediated regulation of cell motility through modulation of beta4 integrin protein levels in oral tumor derived cells.
26617803 2015 Pituitary tumor transforming gene PTTG2 induces psoriasis by regulating vimentin and E-cadherin expression.
26567912 2016 Down-regulation of MicroRNAs (MiRs) 203, 887, 3619 and 182 Prevents Vimentin-triggered, Phospholipase D (PLD)-mediated Cancer Cell Invasion.
More...