Property Summary

NCBI Gene PubMed Count 302
Grant Count 23
R01 Count 13
Funding $1,951,034.43
PubMed Score 159.62
PubTator Score 260.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -1.900 0.000
osteosarcoma -1.184 0.002
glioblastoma 2.000 0.001
tuberculosis -1.900 0.000
primary pancreatic ductal adenocarcinoma 1.354 0.016
colon cancer -1.300 0.001
interstitial cystitis 1.300 0.001
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma 1.500 0.002
posterior fossa group A ependymoma 1.300 0.000
subependymal giant cell astrocytoma 1.551 0.022
inflammatory breast cancer 1.200 0.003
lung carcinoma -2.300 0.000
non-small cell lung carcinoma -1.200 0.000
gastric carcinoma 2.000 0.020
ulcerative colitis 1.300 0.002

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2628 confirmatory 0 / 0 / 2 Selectivity Counterscreen Cell Adhesion Assay for Inhibitors of Platelet Integrin alphallb-beta3

Gene RIF (244)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26823759 ITGA5 plays an important role in maintaining and regulating the normal migration capacity of dental pulp stem cells.
26772401 integrin alpha5 might play important roles in the progression of esophageal squamous cell carcinoma
26733684 The present study has revealed an integrin- and membrane lipid raft-dependent mechanotransduction mechanism by which atheroprone flow causes endothelial dysfunction.
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26648324 The aim of the present study was to characterize the roles of ITGalpha5 and ITGbeta1 in the proliferation and migration of vascular smooth muscle cells.
26578516 Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1.
26431475 Collagens considerably suppressed alpha5 gene expression in CECs, suggesting that during wound
26370503 Suggest alpha5beta1/Arp2/Arp3/FHOD3 pathway reprograms the actin cytoskeleton to promote invasive migration and local invasion in vivo.
26244551 Data suggest that the binding, but not the internalization of photoreceptor outer segments (POS) confers protective effects on retinal pigment epithelium (RPE) cells through the alphavbeta5 integrin/focal adhesion kinase (FAK)/PGC-1alpha pathway.
More...

AA Sequence

MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPG      1 - 70
TDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQ     71 - 140
WFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFS    141 - 210
AEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGE    211 - 280
FSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLL    281 - 350
MDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET    351 - 420
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGR    421 - 490
PIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRA    491 - 560
LFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQ    561 - 630
SKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPE    631 - 700
AEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSK    701 - 770
NLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI    771 - 840
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILK    841 - 910
CPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKER    911 - 980
QVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA     981 - 1049
//

Text Mined References (314)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26823759 2015 Effect of ITGA5 down-regulation on the migration capacity of human dental pulp stem cells.
26772401 2016 Integrin ?5 promotes tumor progression and is an independent unfavorable prognostic factor in esophageal squamous cell carcinoma.
26733684 2016 Activation of integrin ?5 mediated by flow requires its translocation to membrane lipid rafts in vascular endothelial cells.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26648324 2016 Effects of integrin ?5?1 on the proliferation and migration of human aortic vascular smooth muscle cells.
26578516 2016 Annexin A6 and Late Endosomal Cholesterol Modulate Integrin Recycling and Cell Migration.
26431475 2015 Functional Impact of Collagens on the Activity Directed by the Promoter of the ?5 Integrin Subunit Gene in Corneal Epithelial Cells.
26370503 2015 ?5?1 integrin recycling promotes Arp2/3-independent cancer cell invasion via the formin FHOD3.
26244551 2015 ?v?5 Integrin/FAK/PGC-1? Pathway Confers Protective Effects on Retinal Pigment Epithelium.
More...