Property Summary

NCBI Gene PubMed Count 329
PubMed Score 169.05
PubTator Score 260.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
colon cancer -1.300 5.7e-04
gastric carcinoma 2.000 2.0e-02
glioblastoma 2.000 9.4e-04
inflammatory breast cancer 1.200 2.6e-03
interstitial cystitis 1.300 9.3e-04
lung adenocarcinoma -1.100 4.1e-09
lung carcinoma -2.300 4.2e-21
malignant mesothelioma -1.400 6.5e-07
non-small cell lung carcinoma -1.200 2.0e-19
osteosarcoma -1.184 1.8e-03
pediatric high grade glioma 1.500 1.6e-03
posterior fossa group A ependymoma 1.300 4.9e-05
primary pancreatic ductal adenocarcinoma 1.354 1.6e-02
psoriasis -1.900 2.4e-04
subependymal giant cell astrocytoma 1.551 2.2e-02
tuberculosis -1.900 1.6e-08
ulcerative colitis 1.300 2.3e-03

Gene RIF (264)

AA Sequence

MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPG      1 - 70
TDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQ     71 - 140
WFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFS    141 - 210
AEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGE    211 - 280
FSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLL    281 - 350
MDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET    351 - 420
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGR    421 - 490
PIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRA    491 - 560
LFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQ    561 - 630
SKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPE    631 - 700
AEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSK    701 - 770
NLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI    771 - 840
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILK    841 - 910
CPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKER    911 - 980
QVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA     981 - 1049
//

Text Mined References (341)

PMID Year Title