Property Summary

NCBI Gene PubMed Count 379
PubMed Score 1691.48
PubTator Score 2049.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 1.6e-85
lung carcinoma 2843 9.8e-26
lung adenocarcinoma 2716 1.5e-04
inflammatory breast cancer 286 9.5e-03
breast carcinoma 1638 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.600 1.6e-85
breast carcinoma 1.100 1.4e-02
inflammatory breast cancer 1.700 9.5e-03
lung adenocarcinoma -1.400 1.5e-04
lung carcinoma -2.300 9.8e-26

 GO Function (1)

 OMIM Phenotype (1)

 CSPA Cell Line (3)

Protein-protein Interaction (3)

Gene RIF (398)

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK                              211 - 254
//

Text Mined References (385)

PMID Year Title