Property Summary

NCBI Gene PubMed Count 342
Grant Count 314
R01 Count 176
Funding $37,014,515.52
PubMed Score 1623.60
PubTator Score 2049.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.100 0.014
lung adenocarcinoma -1.400 0.000
inflammatory breast cancer 1.700 0.010
lung carcinoma -2.300 0.000
psoriasis 2.600 0.000

Synonym

Accession P08637 A2N6W9 Q53FJ0 Q53FL6 Q5EBR4 Q65ZM6 Q6PIJ0
Symbols CD16
FCG3
CD16A
FCGR3
IGFR3
IMD20
FCR-10
FCRIII
FCGRIII
FCRIIIA

Gene

PANTHER Protein Class (1)

PDB

3AY4   3SGJ   3SGK   3WN5   5BW7   5D6D  

Gene RIF (363)

PMID Text
27004307 The correlation could not be found between FcgammaRIIIa polymorphisms to the response of rituximab in Thai patients with diffuse large B-cell lymphoma.
26658828 PAR-2 expression is increased on CD14++CD16+ monocytes in the peripheral blood of subjects with severe asthma and may be a biomarker of asthma severity.
26582197 Data suggest that immune complexes (ICs) of FCGR3A-SYK play critical role in activation of CD4+ T-cells and thus in modulation of adaptive immunity; such ICs are present in blood from patients with systemic lupus erythematosus.
26582002 These results suggest that the structure and expression of the CD16 molecule differs among FcgammaRIIIa-V158F genotypes, and the FcgammaRIIIa-V158F polymorphism may be represent a haplotype with other SNPs in regulatory regions in Japanese subjects.
26517570 Single-nucleotide polymorphisms of FCGR3A gene is associated with bloodstream infections After Liver Transplantation.
26510856 FCGR3A and FCGR2A SNPs do not confer differential responsiveness to rituximab.
26450443 FcgammaRIIIA/FcgammaRIIA gene polymorphisms and HER-2 may have a role in antibody-dependent cellular cytotoxicity and clinical response to trastuzumab in breast cancer
26444434 This study demonstrated the biological importance of human IgG1-Fc Tyr-296 for interactions with Fc gamma receptor III-A by protein engineering and X-ray structural analysis.
26367501 The rs396991 TaqMan assay (C__25815666_10) agrees with Sanger sequencing results in 100% of European and Asian samples tested, but it has a small error rate in African and American populations.
26363448 KRAS wild chemorefractory metastatic colorectal cancer patients with genotype FF of V158F can benefit from cetuximab based therapy
More...

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK                              211 - 254
//

Text Mined References (348)

PMID Year Title
27004307 2015 Correlation of Fc?RIIIa Polymorphisms to the Response of Rituximab in Thai Patients with Diffuse Large B-Cell Lymphoma.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26658828 2015 Increased Protease-Activated Receptor-2 (PAR-2) Expression on CD14++CD16+ Peripheral Blood Monocytes of Patients with Severe Asthma.
26582197 2016 Fc?RIIIa-Syk Co-signal Modulates CD4+ T-cell Response and Up-regulates Toll-like Receptor (TLR) Expression.
26582002 2016 The influence of NK cell-mediated ADCC: Structure and expression of the CD16 molecule differ among Fc?RIIIa-V158F genotypes in healthy Japanese subjects.
26517570 2016 Fc-Gamma Receptor Polymorphisms Predispose Patients to Infectious Complications After Liver Transplantation.
26510856 2016 Fc Gamma Receptor 3A and 2A Polymorphisms Do Not Predict Response to Rituximab in Follicular Lymphoma.
26450443 2015 Analysis of in vitro ADCC and clinical response to trastuzumab: possible relevance of Fc?RIIIA/Fc?RIIA gene polymorphisms and HER-2 expression levels on breast cancer cell lines.
26444434 2015 Importance of the Side Chain at Position 296 of Antibody Fc in Interactions with Fc?RIIIa and Other Fc? Receptors.
26367501 2015 Accurate interrogation of FCGR3A rs396991 in European and Asian populations using a widely available TaqMan genotyping method.
More...