Property Summary

Ligand Count 87
NCBI Gene PubMed Count 142
PubMed Score 3192.67
PubTator Score 181.40

Knowledge Summary

Patent (25,283)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.168 2.1


 GWAS Trait (1)

Gene RIF (114)

AA Sequence

MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP                                      491 - 526

Text Mined References (167)

PMID Year Title