Property Summary

Ligand Count 92
NCBI Gene PubMed Count 142
PubMed Score 3192.67
PubTator Score 181.40

Knowledge Summary

Patent (25,283)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.168 2.1

Expression

 GWAS Trait (1)

PDB (37)

Gene RIF (114)

AA Sequence

MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT      1 - 70
PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE     71 - 140
TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI    141 - 210
SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT    211 - 280
YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG    281 - 350
SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP    351 - 420
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM    421 - 490
MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP                                      491 - 526
//

Text Mined References (167)

PMID Year Title