Property Summary

NCBI Gene PubMed Count 136
PubMed Score 2983.51
PubTator Score 181.40

Knowledge Summary

Patent (25,283)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.55497352193898E-26
non-small cell lung cancer 2798 2.34407785234319E-13
chronic lymphosyte leukemia 232 1.38541944993794E-8
ovarian cancer 8492 7.09620587039442E-7
invasive ductal carcinoma 2950 4.08334328999515E-5
ulcerative colitis 2087 9.30882053532732E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.88013157687444E-4
interstitial cystitis 2299 0.00250076830194274
adrenocortical carcinoma 1427 0.00264058453874128
head and neck cancer and chronic obstructive pulmonary disease 237 0.00274663557803739
osteosarcoma 7933 0.00399456539785052
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00452483990637477
glioblastoma 5572 0.00455579090924561
cutaneous lupus erythematosus 1056 0.00721943977827272
tuberculosis and treatment for 6 months 686 0.00829572226588752
nephrosclerosis 329 0.00863479511002211
subependymal giant cell astrocytoma 2287 0.00982204818620054
mucosa-associated lymphoid tissue lymphoma 480 0.010512493696676
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0314881126722346
gastric carcinoma 832 0.0489419146506549
Disease Target Count Z-score Confidence
Cancer 2346 4.115 2.1

Expression

Synonym

Gene

HCK

PDB

1AD5   1BU1   1QCF   2C0I   2C0O   2C0T   2HCK   2HK5   2OI3   2OJ2   3HCK   3NHN   3RBB   3REA   3REB   3VRY   3VRZ   3VS0   3VS1   3VS2   3VS3   3VS4   3VS5   3VS6   3VS7   4HCK   4LUD   4LUE   4ORZ   4U5W   5HCK  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (110)

PMID Text
26440750 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25972488 we provide evidence for involvement of HCK and FGR in FCRL4-mediated immunoregulation and for the functional importance of posttranslational modifications of the FCRL4 molecule.
25807049 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25745180 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25666803 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25527710 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25122770 Interaction with the Src homology (SH3-SH2) region of the Hck structures the HIV-1 Nef dimer for kinase activation and effector recruitment.
25122770 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24722985 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24451644 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
More...

AA Sequence

MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT      1 - 70
PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE     71 - 140
TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI    141 - 210
SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT    211 - 280
YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG    281 - 350
SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP    351 - 420
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM    421 - 490
MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP                                      491 - 526
//

Text Mined References (161)

PMID Year Title
25972488 2015 Involvement of the HCK and FGR src-family kinases in FCRL4-mediated immune regulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25469238 2015 Molecular characterization of WDCP, a novel fusion partner for the anaplastic lymphoma tyrosine kinase ALK.
25416956 2014 A proteome-scale map of the human interactome network.
25122770 2014 Interaction with the Src homology (SH3-SH2) region of the Src-family kinase Hck structures the HIV-1 Nef dimer for kinase activation and effector recruitment.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...