Property Summary

NCBI Gene PubMed Count 724
PubMed Score 1420.92
PubTator Score 1692.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.7
Skin cancer 469 0.0 0.7
Disease Target Count Z-score Confidence
Kidney disease 430 4.382 2.2
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 0.0 4.0

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma -1.975 2.6e-04
Astrocytoma, Pilocytic 1.500 2.9e-03
Atopic dermatitis -2.200 1.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.970 7.3e-04
Becker muscular dystrophy 1.015 1.4e-02
breast carcinoma -1.900 6.8e-06
colon cancer -2.200 5.5e-03
cystic fibrosis 2.434 2.0e-07
Duchenne muscular dystrophy 2.242 6.7e-08
ductal carcinoma in situ -1.700 5.7e-04
fascioscapulohumeral muscular dystrophy 1.006 4.9e-04
fibroadenoma -1.500 2.4e-02
interstitial lung disease 1.200 4.0e-02
intraductal papillary-mucinous adenoma (... -1.900 3.6e-02
intraductal papillary-mucinous carcinoma... -4.200 6.0e-04
invasive ductal carcinoma -2.500 2.0e-04
juvenile dermatomyositis 1.878 4.0e-13
limb girdle muscular dystrophy 2A 1.435 3.8e-05
lung adenocarcinoma -1.200 2.5e-03
lung cancer -1.500 3.6e-04
lung carcinoma -2.400 3.1e-16
malignant mesothelioma -2.400 1.1e-07
non-small cell lung cancer -1.301 7.5e-09
oligodendroglioma -1.400 2.8e-02
ovarian cancer -4.500 6.4e-09
pancreatic ductal adenocarcinoma liver m... -1.929 7.0e-03
Pick disease 1.600 2.2e-02
pituitary cancer -1.800 2.0e-04
psoriasis -2.100 1.4e-05
sonic hedgehog group medulloblastoma 1.200 1.3e-02

Protein-protein Interaction (2)

Gene RIF (750)

AA Sequence

MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGE      1 - 70
WVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPI     71 - 140
CEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISC    141 - 210
KSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPL    211 - 280
RIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVG    281 - 350
KYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGY    351 - 420
ALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSG    421 - 490
SITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSD    491 - 560
LPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSC    561 - 630
GPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHG    631 - 700
WAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKE    701 - 770
FDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQ    771 - 840
ENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEE    841 - 910
NETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSH    911 - 980
PPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVN    981 - 1050
PPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDI   1051 - 1120
TSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLY   1121 - 1190
SRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR                                1191 - 1231
//

Text Mined References (730)

PMID Year Title