Property Summary

NCBI Gene PubMed Count 36
PubMed Score 103.68
PubTator Score 60.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -3.574 6.3e-09
Amyotrophic lateral sclerosis -1.610 1.2e-04
limb girdle muscular dystrophy 2A -1.158 8.8e-03

Protein-protein Interaction (5)

Gene RIF (17)

AA Sequence

MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK      1 - 70
ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF     71 - 140
DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS                   141 - 195
//

Text Mined References (37)

PMID Year Title