Property Summary

NCBI Gene PubMed Count 325
Grant Count 228
R01 Count 113
Funding $24,311,482.54
PubMed Score 694.12
PubTator Score 921.50

Knowledge Summary

Patent (8,190)

TINX Plot

  Disease Relevance (96)

Disease Z-score Confidence
Heart disease 279 5.1 2.5
Hypertension 287 4.703 2.4
Coronary artery disease 240 4.037 2.0
Cerebrovascular disease 231 3.112 1.6
Acute coronary syndrome 37
Acute exacerbation of asthma 14
Angina pectoris 21
Anxiety 24
Arrhythmias During Surgery 2
Asthma 349
Asthma management 20
Atopic dermatitis 944
Atrial Fibrillation 110
Atrioventricular block 21
Birth Weight 9
Bronchiectasis 29
Bronchitis 44
Cardiac Decompensation 2
Cardiac Decompensation Post Cardiac Surg... 2 
Cardiac Function Studies 1
Cardiac arrest 26
Cardiogenic shock 2
Cardiomyopathy, Dilated 47
Cardiovascular Diseases 50
Chronic heart failure 46
Common cold 63
Decompensated cardiac failure 9
Endomyocardial Fibrosis 10
Essential Hypertension 82 2.0
Essential tremor 30
Glaucoma 134
Heart failure 80
Hemangioma 35
Hyperemia 13
Hypertensive disease 193
Hypertensive disorder 58
Hypertrophic Cardiomyopathy 56
Hypovolemic shock 2
Idiopathic hypertrophic subaortic stenos... 2 
Left ventricular cardiac dysfunction 9
Life-Threatening Ventricular Tachycardia 15
Lipid storage disease 7 1.0
Low blood pressure 9
Low cardiac output syndrome 2
Migraine Prevention 22
Myocardial Infarction 126
Myocardial Ischemia 169
Myocardial Reinfarction Prevention 6
Myocardial Reperfusion Injury 34
Obesity 616
Ocular hypertension 27
Open-angle glaucoma 26
Organic Cardiac Disease 2
Orthostatic hypotension 9
Parkinson's disease 364
Paroxysmal atrial fibrillation 6
Paroxysmal atrial flutter 2
Paroxysmal supraventricular tachycardia 11
Perioperative Tachycardia 1
Perioperative hypertension 5
Pheochromocytoma Adjunct Therapy 2
Pulmonary emphysema 34
Stomach Neoplasms 282
Supraventricular tachycardia 2
Syncope due to Heart Block 2
Tachyarrhythmia 2
Thick Bronchial Secretions 2
Ventricular Dysfunction 7
Ventricular arrhythmia 14
Ventricular premature beats 1
active Crohn's disease 918
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
chronic rhinosinusitis 512
diabetes mellitus 1,663
ductal carcinoma in situ 1,745
glioblastoma 5,572
group 3 medulloblastoma 2,254
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
interstitial lung disease 291
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis and treatment for 6 months 686

Expression

Synonym

Accession P08588 B0LPE2 Q5T5Y4 Q9UKG7 Q9UKG8
Symbols RHR
B1AR
ADRB1R
BETA1AR

Gene

PANTHER Protein Class (2)

PDB

2LSQ  

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (354)

PMID Text
26313487 In healthy individuals, heart rate and renin responses to dobutamine were more than three-fold greater among ADRB1 Arg389 compared with Gly389 homozygotes.
26248277 Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology.
26125791 the b1 adrenergic receptor gene Arg389Gly polymorphism might not be associated with heart failure risk
26058836 ADRB1 is associated with heart rate recovery after exercise.
25837585 negative cooperativity across a beta1-adrenoceptor homodimer may be responsible for generating the low-affinity pharmacology of the secondary beta1-adrenoceptor conformation
25823457 There was no significant interaction between the effects of ADRB1 and CYP2D6 gene polymorphisms on treatment outcome. Patients homozygous for the mutant ADRB1 genotype (CC) had better treatment outcomes than those heterozygous for the mutation (GC).
25815601 This evidence, in combination with clinical studies, may contribute to a detailed analysis of the pattern of susceptibility to CVD involved in b-ADR1 receptor mechanism failure.
25673629 beta2-Stimulation is, therefore, more arrhythmogenic than beta1-stimulation in heart failure.
25638254 This study sought to identify the distributed characteristics of these variant genotypes in Chinese population, and influence of GRK5 and ADRB1 polymorphisms on systolic heart failure morbidity.
25614626 Our data suggest that PIST contributes to the fine-tuning of b1AR sorting both during biosynthetic and postendocytic trafficking
More...

AA Sequence

MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVL      1 - 70
LIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVL     71 - 140
CVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCY    141 - 210
NDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPV    211 - 280
PAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFH    281 - 350
RELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP    351 - 420
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV                 421 - 477
//

Text Mined References (326)

PMID Year Title
26313487 2015 Effects of sex and the common ADRB1 389 genetic polymorphism on the hemodynamic response to dobutamine.
26248277 2015 ?2- and ?1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
26125791 2015 Association between ?1 adrenergic receptor gene Arg389Gly polymorphism and risk of heart failure: a meta-analysis.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25837585 2015 Negative cooperativity across ?1-adrenoceptor homodimers provides insights into the nature of the secondary low-affinity CGP 12177 ?1-adrenoceptor binding conformation.
25823457 2015 Associations between ADRB1 and CYP2D6 gene polymorphisms and the response to ?-blocker therapy in hypertension.
25815601 2015 Ser49Gly polymorphism in the ?-adrenergic receptor 1 gene in a population sample from Rio de Janeiro state, Brazil, stratified by self-identified skin color and genetic ancestry.
25673629 2015 Arrhythmogenic remodeling of ?2 versus ?1 adrenergic signaling in the human failing heart.
25638254 2015 Effects of GRK5 and ADRB1 polymorphisms influence on systolic heart failure.
25614626 2015 The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
More...