Property Summary

NCBI Gene PubMed Count 325
PubMed Score 694.12
PubTator Score 921.50

Knowledge Summary

Patent (8,190)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 2.77619599285484E-37
non-small cell lung cancer 2798 8.16293151365838E-27
lung adenocarcinoma 2714 1.54868928299695E-15
posterior fossa group B ependymoma 1530 4.34488187988582E-14
atypical teratoid / rhabdoid tumor 4369 5.53007611248461E-10
lung carcinoma 2844 1.36062444429131E-8
interstitial cystitis 2299 1.64405020850728E-5
primitive neuroectodermal tumor 3031 3.15682784071534E-5
osteosarcoma 7933 5.72738087509724E-5
group 3 medulloblastoma 2254 6.63721330595298E-5
pilocytic astrocytoma 3086 1.17394340365987E-4
invasive ductal carcinoma 2950 1.2020783361773E-4
Atopic dermatitis 944 5.15626653325664E-4
head and neck cancer and chronic obstructive pulmonary disease 237 0.00112707432336849
astrocytic glioma 2241 0.0024908005207241
tuberculosis and treatment for 6 months 686 0.00379570956833481
ductal carcinoma in situ 1745 0.00389407426115575
pancreatic cancer 2300 0.00452946143727834
pancreatic carcinoma 567 0.00452946143727834
adult high grade glioma 2148 0.00913230572418716
oligodendroglioma 2849 0.0101498426784484
medulloblastoma, large-cell 6234 0.0182217817382829
active Crohn's disease 918 0.0246281335442083
glioblastoma 5572 0.0315338852219052
chronic rhinosinusitis 512 0.0331285316294243
interstitial lung disease 292 0.0475036544018333
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Lipid storage disease 7 0.0 1.0

Expression

Synonym

Accession P08588 B0LPE2 Q5T5Y4 Q9UKG7 Q9UKG8
Symbols RHR
B1AR
ADRB1R
BETA1AR

Gene

PANTHER Protein Class (2)

PDB

2LSQ  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (354)

PMID Text
26313487 In healthy individuals, heart rate and renin responses to dobutamine were more than three-fold greater among ADRB1 Arg389 compared with Gly389 homozygotes.
26248277 Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology.
26125791 the b1 adrenergic receptor gene Arg389Gly polymorphism might not be associated with heart failure risk
26058836 ADRB1 is associated with heart rate recovery after exercise.
25837585 negative cooperativity across a beta1-adrenoceptor homodimer may be responsible for generating the low-affinity pharmacology of the secondary beta1-adrenoceptor conformation
25823457 There was no significant interaction between the effects of ADRB1 and CYP2D6 gene polymorphisms on treatment outcome. Patients homozygous for the mutant ADRB1 genotype (CC) had better treatment outcomes than those heterozygous for the mutation (GC).
25815601 This evidence, in combination with clinical studies, may contribute to a detailed analysis of the pattern of susceptibility to CVD involved in b-ADR1 receptor mechanism failure.
25673629 beta2-Stimulation is, therefore, more arrhythmogenic than beta1-stimulation in heart failure.
25638254 This study sought to identify the distributed characteristics of these variant genotypes in Chinese population, and influence of GRK5 and ADRB1 polymorphisms on systolic heart failure morbidity.
25614626 Our data suggest that PIST contributes to the fine-tuning of b1AR sorting both during biosynthetic and postendocytic trafficking
More...

AA Sequence

MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVL      1 - 70
LIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVL     71 - 140
CVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCY    141 - 210
NDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPV    211 - 280
PAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFH    281 - 350
RELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP    351 - 420
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV                 421 - 477
//

Text Mined References (326)

PMID Year Title
26313487 2015 Effects of sex and the common ADRB1 389 genetic polymorphism on the hemodynamic response to dobutamine.
26248277 2015 ?2- and ?1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
26125791 2015 Association between ?1 adrenergic receptor gene Arg389Gly polymorphism and risk of heart failure: a meta-analysis.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25837585 2015 Negative cooperativity across ?1-adrenoceptor homodimers provides insights into the nature of the secondary low-affinity CGP 12177 ?1-adrenoceptor binding conformation.
25823457 2015 Associations between ADRB1 and CYP2D6 gene polymorphisms and the response to ?-blocker therapy in hypertension.
25815601 2015 Ser49Gly polymorphism in the ?-adrenergic receptor 1 gene in a population sample from Rio de Janeiro state, Brazil, stratified by self-identified skin color and genetic ancestry.
25673629 2015 Arrhythmogenic remodeling of ?2 versus ?1 adrenergic signaling in the human failing heart.
25638254 2015 Effects of GRK5 and ADRB1 polymorphisms influence on systolic heart failure.
25614626 2015 The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
More...