Property Summary

NCBI Gene PubMed Count 45
PubMed Score 92.48
PubTator Score 266.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.100 6.5e-05
intraductal papillary-mucinous neoplasm ... 1.200 1.2e-02
lung adenocarcinoma 2.500 7.9e-08
medulloblastoma -1.100 1.9e-04
medulloblastoma, large-cell -1.400 1.5e-03
non-small cell lung cancer 2.363 1.5e-17
osteosarcoma 2.053 3.6e-02
ovarian cancer -2.200 1.8e-06
pancreatic cancer 1.100 8.1e-04
pancreatic ductal adenocarcinoma liver m... 2.041 1.4e-02
psoriasis -1.300 1.8e-06
tuberculosis -1.500 2.7e-06

 GO Function (1)

Gene RIF (17)

AA Sequence

MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ      1 - 70
EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW     71 - 140
NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDY    141 - 210
SGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHA    211 - 280
VVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLH    281 - 350
AMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL    351 - 420
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPV    421 - 490
GALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAF    491 - 560
RCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVR    561 - 630
PDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAA    631 - 700
LEGMSSQQCSGAAAPAPGAPLLPLLLPALAARLLPPAL                                    701 - 738
//

Text Mined References (48)

PMID Year Title