Property Summary

NCBI Gene PubMed Count 45
Grant Count 1
Funding $444,000
PubMed Score 89.69
PubTator Score 266.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 2.053 0.036
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.400 0.001
pancreatic ductal adenocarcinoma liver m... 2.041 0.014
tuberculosis -1.700 0.000
non-small cell lung cancer 2.363 0.000
intraductal papillary-mucinous neoplasm ... 1.800 0.003
pancreatic cancer 1.100 0.001
lung adenocarcinoma 2.500 0.000
psoriasis -1.300 0.000
Breast cancer -1.800 0.000
ovarian cancer 2.500 0.000

Synonym

Accession P08582 Q9BQE2
Symbols MTf
MFI2
MTF1
CD228
MAP97

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (16)

PMID Text
25216327 Melanotransferrin is a serological marker of colorectal cancer by secretome analysis and quantitative proteomics.
21190562 PC3 tumors are sustained by a small number of tumor-initiating cells with stem-like characteristics, including strong self-renewal and pro-angiogenic capability and marked by the expression pattern FAM65Bhigh/MFI2low/LEF1low.
18691669 Biochemical and spectroscopic studies of MTF1 are reported.
17570828 results suggest a Plg-mediated internalization mechanism for the clearance of sMTf via annexin II and LRP
17452986 this review discusses the studies that have demonstrated that melanotransferrin is not involved in iron metabolism, but plays a vital role in melanoma cell proliferation and tumorigenesis.
17449903 Novel molecular targets directly or indirectly regulated by MTf and the potential pathways involved in its function, including modulation of proliferation.
17227112 HMB-45 (melanoma-associated antigen p97) and Melan-A combined were positive in 100% of the renal angiomyolipomas
17196552 Altogether, these findings strongly suggest that MTf overexpression in melanoma cells contributes to tumor progression by stimulating plasmin generation as well as cell migration and invasion.
16713448 Anti-angiogenic properties of soluble melanotransferrin may result from local overstimulation of plasminogen activation by tissue plasminogen activator, thus leading to subsequent degradation of the fibronectin matrix and endothelial cell detachment.
16704991 melanotransferrin has a role in cell proliferation and tumorigenesis
More...

AA Sequence

MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ      1 - 70
EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW     71 - 140
NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDY    141 - 210
SGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHA    211 - 280
VVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLH    281 - 350
AMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL    351 - 420
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPV    421 - 490
GALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAF    491 - 560
RCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVR    561 - 630
PDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAA    631 - 700
LEGMSSQQCSGAAAPAPGAPLLPLLLPALAARLLPPAL                                    701 - 738
//

Text Mined References (48)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25416956 2014 A proteome-scale map of the human interactome network.
25216327 2014 Discovery of melanotransferrin as a serological marker of colorectal cancer by secretome analysis and quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21190562 2010 PC3 prostate tumor-initiating cells with molecular profile FAM65Bhigh/MFI2low/LEF1low increase tumor angiogenesis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19815549 2009 Meckel-Gruber syndrome protein MKS3 is required for endoplasmic reticulum-associated degradation of surfactant protein C.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...