Property Summary

NCBI Gene PubMed Count 27
PubMed Score 3.02
PubTator Score 1.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 467 7.6e-07
lung cancer 4740 4.3e-03
breast carcinoma 1638 3.0e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.100 3.0e-02
lung cancer 1.700 4.3e-03
sonic hedgehog group medulloblastoma 1.200 7.6e-07

Gene RIF (2)

AA Sequence

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQ      1 - 70
GFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTP     71 - 140
NPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGF    141 - 210
KITPSHAMKITYAKK                                                           211 - 225
//

Text Mined References (31)

PMID Year Title