Property Summary

NCBI Gene PubMed Count 252
Grant Count 655
R01 Count 322
Funding $91,901,927.22
PubMed Score 4489.13
PubTator Score 2559.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Cancer 2,346 6.072 3.0
Leber congenital amaurosis 72 5.376 2.7
Vascular disease 281 4.453 2.2
Hypersensitivity reaction type II diseas... 235  4.198 2.1
Severe Combined Immunodeficiency 46 4.111 2.1
Acquired immunodeficiency syndrome 164 3.84 1.9
Lymphatic system disease 14 3.65 1.8
Anemia 252 3.631 1.8
Multiple Sclerosis 498 3.592 1.8
Lung disease 132 3.465 1.7
Multicentric reticulohistiocytosis 4 3.344 1.7
Kidney disease 396 3.299 1.6
Arthritis 248 3.224 1.6
Inflammatory bowel disease 142 3.212 1.6
diabetes mellitus 1,663 3.172 1.6
Heart disease 279 3.113 1.6
Leukopenia 42 3.015 1.5
Carcinoma 2,147 1.0
Duchenne muscular dystrophy 602
HEPATITIS C VIRUS, SUSCEPTIBILITY TO 3
Hepatitis C 90
IGA Glomerulonephritis 454
Peripheral vascular disease 90 2.0
Retinal Diseases 21
Rheumatoid Arthritis 1,160 5.0
Severe Combined Immunodeficiency, Autoso... 4 
Waldenstrons macroglobulinemia 765
aldosterone-producing adenoma 664
chronic kidney disease 90
cutaneous lupus erythematosus 1,056
dermatomyositis 933
glioblastoma 5,572
group 3 medulloblastoma 2,254
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nephrosclerosis 329
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P08575 A8K7W6 Q16614 Q9H0Y6
Symbols LCA
LY5
B220
CD45
L-CA
T200
CD45R
GP180

Gene

PDB

1YGR   1YGU   5FMV   5FN6   5FN7  

 GWAS Trait (1)

Gene RIF (194)

PMID Text
26998761 Data show the structural basis for, and the potent signaling effects of, local CD45 antigen and kinase segregation.
26994849 High CD45 expression is associated with multiple myeloma.
26678911 CD45RO in tumor-infiltrating lymphocytes was found to be a positive prognostic factor in squamous non-small cell lung cancer.
26667768 CD45RO+ memory T-cells produce IL-17 in patients with atherosclerosis.
26389592 Findings indicate that CD45 antigen(+) and c-Kit protein(+) hematopoietic cells were more abundant in muscle than in bone marrow between embryonic 14.5 and 17.5 days.
26355564 C77G T(reg) showed diminished upregulation of activation markers, lower phosphorylation of p56(lck)(Y505) and a reduced proliferative potential when stimulated with anti-TcR or anti-TcR plus CD28 mAb suggesting decreased responsiveness to activating stimuli. Data suggest that the changes in CD45 isoform combination resulting from the C77G mutation alter the responsiveness
25896535 PTPRC has become the most replicated genetic biomarker of response to TNF inhibitors
25834819 This study did not replicate the association between PTPRC and the response to anti-TNF treatment in our Southern European population. We found that TRAF1/C5 risk RA variants potentially influence anti-TNF treatment response.
25804232 Patients with the presence of CD8- and CD45RO-positive T cells in bone marrow demonstrated better survival of gastric cancer patients than those with the absence of these cells in bone marrow.
25739938 a CD45+/CD19 - cell population in bone marrow aspirates correlated with the clinical outcome of patients with mantle cell lymphoma.
More...

AA Sequence

MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSET      1 - 70
TTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGS     71 - 140
NAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASETTTLSPSGSA    141 - 210
VISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVS    211 - 280
ISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNK    281 - 350
EIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNF    351 - 420
TLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT    421 - 490
VSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYP    491 - 560
GEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIYDLHKKRSCNLDEQQELVERDDEKQLMNVEP    561 - 630
IHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGD    631 - 700
AGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEG    701 - 770
TRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS    771 - 840
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEY    841 - 910
NQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDY    911 - 980
NRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQ    981 - 1050
RKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQY   1051 - 1120
TNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETE   1121 - 1190
EVVDIFQVVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCV   1191 - 1260
NPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS                             1261 - 1304
//

Text Mined References (262)

PMID Year Title
26998761 2016 Initiation of T cell signaling by CD45 segregation at 'close contacts'.
26994849 2016 The prognostic significance of CD45 expression by clonal bone marrow plasma cells in patients with newly diagnosed multiple myeloma.
26678911 2015 CD45RO(+) Memory T Lymphocytes--a Candidate Marker for TNM-Immunoscore in Squamous Non-Small Cell Lung Cancer.
26667768 2015 CD45RO+ memory T-cells produce IL-17 in patients with atherosclerosis.
26389592 2015 Embryonic Hematopoietic Progenitor Cells Reside in Muscle before Bone Marrow Hematopoiesis.
26355564 2015 Overexpression of CD45RA isoforms in carriers of the C77G mutation leads to hyporeactivity of CD4+CD25highFoxp3+ regulatory T cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25896535 2016 Replication of PTPRC as genetic biomarker of response to TNF inhibitors in patients with rheumatoid arthritis.
25834819 2015 TRAF1/C5 but not PTPRC variants are potential predictors of rheumatoid arthritis response to anti-tumor necrosis factor therapy.
25804232 2015 CD8 and CD45RO T lymphocytes in bone marrow of gastric cancer patients: correlation with disseminated tumor cells and disease outcome.
More...