Property Summary

Ligand Count 64
NCBI Gene PubMed Count 266
PubMed Score 4642.97
PubTator Score 2559.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0

Expression

  Differential Expression (33)

Disease log2 FC p
Rheumatoid arthritis 1.700 4.8e-03
diabetes mellitus -1.600 2.5e-02
adult high grade glioma 1.300 1.1e-02
aldosterone-producing adenoma -1.051 4.6e-02
Astrocytoma, Pilocytic 1.700 3.8e-07
chronic kidney disease 1.500 4.1e-03
cutaneous lupus erythematosus 3.100 1.0e-04
dermatomyositis 1.700 8.6e-04
Duchenne muscular dystrophy 1.130 9.4e-06
ependymoma 1.300 3.5e-04
glioblastoma 1.200 5.5e-04
group 3 medulloblastoma -1.300 3.3e-02
head and neck cancer -1.300 1.7e-02
head and neck cancer and chronic obstruc... 1.100 1.2e-02
interstitial cystitis 2.100 2.7e-03
intraductal papillary-mucinous carcinoma... -2.300 2.6e-02
intraductal papillary-mucinous neoplasm ... -2.500 4.0e-02
invasive ductal carcinoma 1.103 2.0e-02
juvenile dermatomyositis 1.521 4.0e-07
lung cancer -3.200 6.4e-05
lung carcinoma -3.800 3.7e-33
medulloblastoma, large-cell -1.300 5.4e-04
nephrosclerosis 1.860 6.9e-03
non primary Sjogren syndrome sicca -1.100 2.7e-02
non-small cell lung cancer -1.066 9.7e-06
osteosarcoma -1.478 5.4e-04
ovarian cancer -2.600 1.7e-06
pituitary cancer 1.800 1.8e-02
primary pancreatic ductal adenocarcinoma 1.081 4.7e-03
psoriasis 1.200 8.5e-04
subependymal giant cell astrocytoma 3.302 6.7e-03
ulcerative colitis 3.000 6.5e-06
Waldenstrons macroglobulinemia 2.450 1.2e-02

Protein-protein Interaction (1)

Gene RIF (206)

AA Sequence

MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSET      1 - 70
TTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGS     71 - 140
NAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASETTTLSPSGSA    141 - 210
VISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVS    211 - 280
ISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNK    281 - 350
EIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNF    351 - 420
TLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT    421 - 490
VSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYP    491 - 560
GEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIYDLHKKRSCNLDEQQELVERDDEKQLMNVEP    561 - 630
IHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGD    631 - 700
AGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEG    701 - 770
TRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS    771 - 840
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEY    841 - 910
NQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDY    911 - 980
NRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQ    981 - 1050
RKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQY   1051 - 1120
TNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETE   1121 - 1190
EVVDIFQVVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCV   1191 - 1260
NPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS                             1261 - 1304
//

Text Mined References (276)

PMID Year Title