Property Summary

NCBI Gene PubMed Count 30
PubMed Score 54.25
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer 1.200 1.3e-02
malignant mesothelioma 1.100 5.0e-06
Multiple myeloma 1.619 1.0e-04
non-small cell lung cancer 1.112 6.5e-16
ovarian cancer 2.100 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.275 8.5e-03
psoriasis 2.600 6.4e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAG      1 - 70
GAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCY     71 - 140
TEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDY    141 - 210
VFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEP    211 - 280
EHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK                             281 - 325
//

Text Mined References (35)

PMID Year Title