Property Summary

NCBI Gene PubMed Count 27
PubMed Score 52.28
PubTator Score 32.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 6.5073787161244E-16
malignant mesothelioma 3163 5.02203523762981E-6
psoriasis 6685 6.42140193405154E-6
Multiple myeloma 1328 1.01168845392654E-4
ovarian cancer 8492 1.39937268236412E-4
lung cancer 4473 2.76075135516905E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00848662822998889
Disease Target Count Z-score Confidence
Contagious pustular dermatitis 12 4.01 2.0
Barth syndrome 23 3.027 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.619 0.000
malignant mesothelioma 1.100 0.000
psoriasis 2.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.275 0.008
non-small cell lung cancer 1.112 0.000
lung cancer 1.400 0.000
ovarian cancer 2.100 0.000

Synonym

Accession P08574 Q5U062 Q6FHS7
Symbols UQCR4
MC3DN6

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (17)

PMID Text
27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
25562155 our results provide evidence that CYC1 plays an important role in OS tumorigenesis, and modulation of CYC1 may be an effective strategy to potentiate OS to apoptotic induction by TRAIL.
23910460 Mutations in CYC1 cause insulin-responsive hyperglycemia.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
21577235 HeLa cells expressing non-cleavable cytochrome c1 maintain mitochondrial morphology and functions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20440543 Decreased electron Transport Complex IV activity is associated with ulcerative colitis.
16699948 Sensitivity of Cyt c detection in -linked immunosorbent assay is reduced in the presence of serum leucine-rich alpha-2-glycoprotein-1.
16511342 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
More...

AA Sequence

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAG      1 - 70
GAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCY     71 - 140
TEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDY    141 - 210
VFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEP    211 - 280
EHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK                             281 - 325
//

Text Mined References (32)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562155 2014 CYC1 silencing sensitizes osteosarcoma cells to TRAIL-induced apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23910460 2013 Mutations in CYC1, encoding cytochrome c1 subunit of respiratory chain complex III, cause insulin-responsive hyperglycemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21577235 2012 Caspase cleavage of cytochrome c1 disrupts mitochondrial function and enhances cytochrome c release.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...