Property Summary

NCBI Gene PubMed Count 89
Grant Count 8
R01 Count 7
Funding $905,929
PubMed Score 74.77
PubTator Score 57.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (49)

Disease Z-score Confidence
Porencephaly 8 5.488 2.7
Alport syndrome 21 3.299 1.6
Becker muscular dystrophy 187
Breast cancer 3,094
Calcification of coronary artery 3
Cardiovascular system disease 194 2.0
Cognitive disorder 44 1.0
DOID:3363 2 1.0
Duchenne muscular dystrophy 602
Hydrolethalus syndrome 128
Infectious Canine Hepatitis 2
Nephrotic Syndrome 48
PORENCEPHALY 2 1
PORENCEPHALY, FAMILIAL 2
Small cell carcinoma of lung 45
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
cystic fibrosis 1,665
dermatomyositis 933
ductal carcinoma in situ 1,745
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung adenocarcinoma 2,713
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
periodontitis 269
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
pterygium 74
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Gene RIF (34)

PMID Text
26343951 No significant change in canstatin levels was observed between normotensive and pre-eclampsia patients.
26310581 SMAD3 is a necessary factor for TGFbeta-mediated stimulation of mRNA and protein expression of type IV collagen genes in human vascular smooth muscle cells; it regulates expression of COL4a1 and COL4a2
26209635 analysis of the unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide COL4a1/COL4a2 containing a natural interruption site
26006016 Studied the role of alpha1 and alpha2 chains of type IV collagen in UIP; found type IV collagen deposition in early fibrotic lesions of UIP may be implicated in refractory pathophysiology including migration of lesion fibroblasts via a FAK pathway.
25653287 An association was found between common variation in the COL4A2 gene and sporadic cerebral small vessel disease.
25169943 Reduction of COL4A2 expression by RNAI-mediated knockdown induces cell death. Finally, elevated Notch3 expression levels correlate with higher COL4A2 expression in human ovarian tumor specimens
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24503185 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24317722 The whole exome sequencing showed no pathological mutations of COL4A1 and COL4A2 in fetal intraventricular hemorrhage
More...

AA Sequence

MGRDQRAVAGPALRRWLLLGTVTVGFLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGRGQPGPVGPQG      1 - 70
YNGPPGLQGFPGLQGRKGDKGERGAPGVTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGT     71 - 140
QGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDRYRGEPGEPGLVGFQGPPGRPGHVGQMGPV    141 - 210
GAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGS    211 - 280
EGEPGIRGISLKGEEGIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPA    281 - 350
YSPHPSLAKGARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPAL    351 - 420
YGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGSPGARGPKGWKGDAGECRCTEGDE    421 - 490
AIKGLPGLPGPKGFAGINGEPGRKGDRGDPGQHGLPGFPGLKGVPGNIGAPGPKGAKGDSRTITTKGERG    491 - 560
QPGVPGVPGMKGDDGSPGRDGLDGFPGLPGPPGDGIKGPPGDPGYPGIPGTKGTPGEMGPPGLGLPGLKG    561 - 630
QRGFPGDAGLPGPPGFLGPPGPAGTPGQIDCDTDVKRAVGGDRQEAIQPGCIGGPKGLPGLPGPPGPTGA    631 - 700
KGLRGIPGFAGADGGPGPRGLPGDAGREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGER    701 - 770
GLPGEVLGAQPGPRGDAGVPGQPGLKGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGL    771 - 840
HGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGID    841 - 910
GMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPP    911 - 980
VILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGF    981 - 1050
PGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGF   1051 - 1120
FGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFP   1121 - 1190
GLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPG   1191 - 1260
SPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGD   1261 - 1330
SGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQ   1331 - 1400
PGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAP   1401 - 1470
GRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLAR   1471 - 1540
FSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIP   1541 - 1610
HCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP   1611 - 1680
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL                                         1681 - 1712
//

Text Mined References (93)

PMID Year Title
26343951 2015 Anti-angiogenic collagen fragment arresten is increased from 16 weeks' gestation in pre-eclamptic plasma.
26310581 2015 Functional interaction between COL4A1/COL4A2 and SMAD3 risk loci for coronary artery disease.
26209635 2015 NMR studies demonstrate a unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide containing a natural interruption site.
26006016 2015 Role of ?1 and ?2 chains of type IV collagen in early fibrotic lesions of idiopathic interstitial pneumonias and migration of lung fibroblasts.
25653287 2015 Common variation in COL4A1/COL4A2 is associated with sporadic cerebral small vessel disease.
25169943 2015 Notch3 overexpression promotes anoikis resistance in epithelial ovarian cancer via upregulation of COL4A2.
24503185 2014 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24317722 2014 Is there relation between COL4A1/A2 mutations and antenatally detected fetal intraventricular hemorrhage?
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
More...