Property Summary

NCBI Gene PubMed Count 649
Grant Count 906
R01 Count 519
Funding $110,397,330.89
PubMed Score 102.03
PubTator Score 2951.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08571 Q53XT5 Q96FR6 Q96L99 Q9UNS3
Symbols

Gene

PDB

4GLP  

Gene RIF (713)

PMID Text
27031691 Mean neopterin and soluble CD14 levels among those with the indeterminate HIV-1 pattern were significantly lower than among the true HIV-1-positive infection.
26927558 Data indicate that in recurrent spontaneous abortion patients, the expression levels of CD49b and LAG-3 (CD223) on CD14(+) mononuclear cells and the plasma level of transforming growth factor beta (TGF-beta) decreased obviously compared with normal females.
26827181 Genetic variation in MORC4, CD14, and TLR4 may affect the outcome of allogeneic stem cell transplantation.
26658828 PAR-2 expression is increased on CD14++CD16+ monocytes in the peripheral blood of subjects with severe asthma and may be a biomarker of asthma severity.
26569178 The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection.
26475135 We found that the frequency of CD14 AA genotype was significantly higher in asthmatic children compared to healthy controls. Asthmatic children carrying GG genotype had a significantly lower prevalence of atopic asthma
26462562 There is evidence for association of gout with functional variants in CARD8, IL1B and CD14.
26443598 There was an increased odds of vertical transmission of HIV for every log2 increase in maternal sCD14 concentration, after adjustment for maternal HIV load, CD4 count and anti-HIV agent exposure.
26437765 Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels.
26365205 Association between CD14 gene promoter polymorphisms with serum total-IgE and eosinophil levels in atopic and non-atopic asthma patients in a Chinese Han population
More...

AA Sequence

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL      1 - 70
KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT     71 - 140
GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER    141 - 210
GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS    211 - 280
LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP    281 - 350
ACARSTLSVGVSGTLVLLQGARGFA                                                 351 - 375
//

Text Mined References (654)

PMID Year Title
27031691 2016 Neopterin and Soluble CD14 Levels as Indicators of Immune Activation in Cases with Indeterminate Pattern and True Positive HIV-1 Infection.
26927558 2016 [Decreased expression levels of LAG-3 and CD49b on CD14+ cells in peripheral blood of patients with recurrent spontaneous abortion].
26827181 2016 Single Nucleotide Polymorphisms in MORC4, CD14, and TLR4 Are Related to Outcome of Allogeneic Stem Cell Transplantation.
26658828 2015 Increased Protease-Activated Receptor-2 (PAR-2) Expression on CD14++CD16+ Peripheral Blood Monocytes of Patients with Severe Asthma.
26569178 2015 Soluble CD163 But Not Soluble CD14 Is Associated With Cytomegalovirus Immunoglobulin G Antibody Levels in Virologically Suppressed HIV+ Individuals.
26475135 2016 Association Between CD14 Polymorphism (-1145G/A) and Childhood Bronchial Asthma.
26462562 2015 Multiplicative interaction of functional inflammasome genetic variants in determining the risk of gout.
26443598 2016 Soluble CD14: An Independent Biomarker for the Risk of Mother-to-Child Transmission of HIV in a Setting of Preexposure and Postexposure Antiretroviral Prophylaxis.
26437765 2015 Angiogenesis related genes NOS3, CD14, MMP3 and IL4R are associated to VEGF gene expression and circulating levels in healthy adults.
26365205 2016 Association between CD14 gene promoter polymorphisms with serum total-IgE and eosinophil levels in atopic and non-atopic asthma patients in a Chinese Han population.
More...