Property Summary

NCBI Gene PubMed Count 38
Grant Count 309
R01 Count 204
Funding $38,822,691.55
PubMed Score 713.73
PubTator Score 376.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 0.001
psoriasis 1.200 0.022
osteosarcoma -2.084 0.011
astrocytoma 2.100 0.017
glioblastoma 2.200 0.005
non-small cell lung cancer -1.085 0.000
lung cancer -3.000 0.000
sarcoidosis 1.400 0.036
breast carcinoma 1.100 0.003
diabetes mellitus -1.400 0.044
interstitial cystitis 2.500 0.003
primary Sjogren syndrome 2.700 0.000
subependymal giant cell astrocytoma 2.607 0.022
invasive ductal carcinoma 1.598 0.002
lung carcinoma -2.800 0.000
ulcerative colitis 3.200 0.000
ovarian cancer -1.400 0.000
head and neck cancer and chronic obstruc... 1.500 0.005

Synonym

Accession P08567 B2R9E8 Q53SU8 Q6FGM8 Q6FGQ1 Q8WV81
Symbols P47

Gene

PANTHER Protein Class (1)

PDB

1PLS   1W4M   1X05   1XX0   1ZM0   2CSO   2I5C   2I5F  

Gene RIF (12)

PMID Text
26686060 Only one gene, pleckstrin , was significantly overexpressed in periodontitis,cardiovascular disease, rheumatoid arthritis and ulcerative colitis , implicating this gene as an important networking link between these chronic inflammatory diseases
26680696 These findings reveal a novel role of the PLD1-pleckstrin homology domain as a positive regulator of endocytosis and provide a link between PLD1 and HIF-1alpha in the EGFR endocytosis pathway.
21393855 crystallization and preliminary X-ray diffraction analysis of the first 2 domains of pleckstrin (NPHDEP); work demonstrates that NPHDEP behaves as a monomer in solution and suggests that all 3 pleckstrin domains contribute to the dimerization interface
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20190752 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19944685 Here they show that the PH domain from Bcr-Abl binds a number of proteins involved in vital cellular processes in leukemogenesis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19722192 Idirect associations between plek and actin through 17 beta-hydroxysteroid dehydrogenase 4, alpha-actinin, moesin, radixin and factor XIIIA, is proposed.
19546854 Proteins beta3 integrin, Vav3, Plekhm1, and Src, implicated in attachment defects, had normal exon sequences in a new type of osteopetrosis.
15698571 The human pleckstrin-1 solution nuclear magnetic resonance structure of the C-terminal pleckstrin homology domain was reported.
More...

AA Sequence

MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFK      1 - 70
ITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGI     71 - 140
KELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFL    141 - 210
DNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDP    211 - 280
AGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK    281 - 350
//

Text Mined References (42)

PMID Year Title
26686060 2015 Transcriptome analysis reveals mucin 4 to be highly associated with periodontitis and identifies pleckstrin as a link to systemic diseases.
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24489884 2014 Genome-wide association study of proneness to anger.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21393855 2011 Crystallization and preliminary diffraction analysis of truncated human pleckstrin.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...