Property Summary

NCBI Gene PubMed Count 38
PubMed Score 743.74
PubTator Score 376.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 2.100 1.7e-02
breast carcinoma 1.100 3.1e-03
cutaneous lupus erythematosus 2.400 1.0e-03
diabetes mellitus -1.400 4.4e-02
glioblastoma 2.200 4.7e-03
head and neck cancer and chronic obstruc... 1.500 4.6e-03
interstitial cystitis 1.800 1.2e-02
invasive ductal carcinoma 1.598 2.2e-03
lung cancer -1.700 6.2e-03
lung carcinoma -2.800 2.0e-24
non-small cell lung cancer -1.085 4.5e-07
osteosarcoma -2.084 1.1e-02
ovarian cancer -1.400 1.3e-04
primary Sjogren syndrome 2.700 1.6e-04
psoriasis 1.200 2.2e-02
sarcoidosis 1.100 3.9e-02
subependymal giant cell astrocytoma 1.578 2.2e-02
ulcerative colitis 1.500 1.0e-02

Synonym

Accession P08567 B2R9E8 Q53SU8 Q6FGM8 Q6FGQ1 Q8WV81
Symbols P47

Gene

PANTHER Protein Class (1)

PDB

1PLS   1W4M   1X05   1XX0   1ZM0   2CSO   2I5C   2I5F  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFK      1 - 70
ITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGI     71 - 140
KELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFL    141 - 210
DNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDP    211 - 280
AGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK    281 - 350
//

Text Mined References (42)

PMID Year Title