Property Summary

NCBI Gene PubMed Count 73
Grant Count 8
R01 Count 6
Funding $1,710,229.24
PubMed Score 190.69
PubTator Score 96.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.140 0.001
astrocytic glioma -1.200 0.024
osteosarcoma -1.418 0.000
glioblastoma -1.100 0.001
acute quadriplegic myopathy 1.064 0.002
intraductal papillary-mucinous neoplasm ... 1.100 0.004
Pick disease -1.100 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.100 0.011
ovarian cancer 2.100 0.000

Gene RIF (28)

PMID Text
26408721 Lack of PDHE1alpha protein expression is associated with Esophageal Squamous Cell Carcinoma.
26309161 oncoprotein HBXIP enhances glucose metabolism reprogramming through suppressing SCO2 and PDHA1 in breast cancer
26107902 MPO and BPI in CD4(+)T-lymphocytes, and PDHA1 and MRPL42 in CD8(+) T-lymphocytes might be used as specific biomarkers of severe asthma progression.
25104357 Phosphorylation at distinct serine and tyrosine residues inhibits PDHA1 through distinct mechanisms to impact active site accessibility.
25060325 High HK2 expression combined with low phosphorylated PDHA1 expression in the invasive front lesions of colorectal tumors is predictive of tumor aggressiveness and survival.
23842279 In the presence of PPARbeta/delta, Vpr induced a 3.3-fold increase in PPAR response element-driven transcriptional activity, a 1.9-fold increase in PDK4 protein expression, and a 1.6-fold increase in the phosphorylated pyruvate dehydrogenase subunit E1alpha.
23842279 HIV-1 Vpr enhances PPARbeta/delta agonist GW501516-induced pyruvate dehydrogenase kinase 4 (PDK4) protein expression and phosphorylation of pyruvate dehydrogenase alpha 1 (PDHE1alpha) at serine 293 in cells
22750801 Expression of the PDHA1 gene was found in all somatic cells, whereas expression of PDHA2 gene was restricted to germ cells. The switch from X-linked to autosomic gene expression occurred in spermatocytes.
22142326 Molecular analysis of PDH1A revealed a novel hemizygous c.1045G>A mutation, predicting a p.A349T missense mutation.
21914562 We provide an efficient stepwise strategy for mutation screening in pyruvate dehydrogenase complex genes and expand the growing list of PDHA1 mutations analyzed at the structural level
More...

AA Sequence

MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQT      1 - 70
VRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTG     71 - 140
RKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNM    141 - 210
AALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPI    211 - 280
LMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA    281 - 350
QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS                                  351 - 390
//

Text Mined References (91)

PMID Year Title
26408721 2015 Decreased Expression of PDHE1? Predicts Worse Clinical Outcome in Esophageal Squamous Cell Carcinoma.
26309161 2015 The oncoprotein HBXIP promotes glucose metabolism reprogramming via downregulating SCO2 and PDHA1 in breast cancer.
26107902 [Comparative analysis of the role of CD4(+) and CD8(+) T cells in severe asthma development].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25104357 2014 Tyr-301 phosphorylation inhibits pyruvate dehydrogenase by blocking substrate binding and promotes the Warburg effect.
25060325 2014 Combined evaluation of hexokinase 2 and phosphorylated pyruvate dehydrogenase-E1? in invasive front lesions of colorectal tumors predicts cancer metabolism and patient prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23842279 2013 HIV-1 Vpr enhances PPAR?/?-mediated transcription, increases PDK4 expression, and reduces PDC activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146587 2013 Experimental determination of organelle targeting-peptide cleavage sites using transient expression of green fluorescent protein translational fusions.
More...