Property Summary

NCBI Gene PubMed Count 364
Grant Count 277
R01 Count 119
Funding $51,518,976.15
PubMed Score 3248.97
PubTator Score 2637.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 0.015
pancreatic cancer 1.800 0.001
osteosarcoma -3.461 0.000
tuberculosis 1.300 0.012
group 4 medulloblastoma 1.100 0.004
pancreatic carcinoma 1.800 0.001

Synonym

Accession P08514 B2RCY8 O95366 Q14443 Q17R67
Symbols GT
GTA
CD41
GP2B
HPA3
CD41B
GPIIb
BDPLT2
BDPLT16
PPP1R93

Gene

PDB

2VDO   2VDP   2VDQ   2VDR   1DPK   1DPQ   1JX5   1KUP   1KUZ   1M8O   1RN0   1S4W   1TYE   1UV9   2K1A   2K9J   2KNC   2MTP   2N9Y   2VC2   2VDK   2VDL   2VDM   2VDN   3FCS   3FCU   3NID   3NIF   3NIG   3T3M   3T3P   3ZDX   3ZDY   3ZDZ   3ZE0   3ZE1   3ZE2   4CAK   4Z7N   4Z7O   4Z7Q   5HDB  

Gene RIF (287)

PMID Text
27093792 Analysis showed a protective effect of TT genotype of ITGA2 807 C/T on fibrosis progression rate in Chronic Hepatitis C patients.
26867579 Monomeric fibrin displayed a higher probability of interacting with Integrin alphaIIb beta 3 and a greater binding strength.
26688324 This study shows correlation of blood clot stiffness with platelet integrin alpha-IIb beta3 activity, aspirin usage, and transfusion risk in cardiopulmonary bypass patients.
26631735 Data suggest that the ligand AGDV tetrapeptide binds to ITGB3/GPIIIa subunit and induces complete opening of headpiece of integrin alphaIIb/beta3 complex; AGDV appears to have very little contact with ITGA2B/GPIIb subunit.
26391523 Activated but ligand-free integrins exist mainly in the compact conformation, whereas fibrin-bound alphaIIbbeta3 predominantly exists in a fully extended, headpiece open conformation.
26359510 Ibrutinib causes GPVI and integrin alphaIIbbeta3 platelet signaling deficiencies that result in formation of unstable thrombi and may contribute toward bleeding.
26301697 Data show that immune thrombocytopenia (ITP) is an autoimmune bleeding disorder characterized by low platelet count and presence of IgG autoantibodies to platelet surface glycoproteins, such as alpha IIbbeta3 integrins.
25827233 Data indicate 114 novel missense variants in integrin alpha 2b (ITGA2B) and 68 novel missense variants in integrin beta 3 (ITGB3).
25632962 Anionic lipids in annular positions stabilize the alphaIIbbeta3 transmembrane complex by up to 0.50 +/- 0.02 kcal/mol relative to zwitterionic lipids in a headgroup structure-dependent manner.
25518511 The genetic polymorphism of GP lIb-Illa (GP Ila Leu33Pro) was not noted to affect platelet aggregation.
More...

AA Sequence

MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGA      1 - 70
PRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAP     71 - 140
WQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAG    141 - 210
ELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLN    211 - 280
TTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRAD    281 - 350
RKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV    351 - 420
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQ    421 - 490
LLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQA    491 - 560
GTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIV    561 - 630
LDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGF    631 - 700
ERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLD    701 - 770
VPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP    771 - 840
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVS    841 - 910
CDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEA    911 - 980
QVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE               981 - 1039
//

Text Mined References (371)

PMID Year Title
27093792 2015 [Mathematic Model for Prediction of Liver Fibrosis Progression Rate in Patients with Chronic Hepatitis C Based on Combination of Genomic Markers].
26867579 2016 The Platelet Integrin ?IIb?3 Differentially Interacts with Fibrin Versus Fibrinogen.
26688324 2016 Sonorheometry assessment of platelet function in cardiopulmonary bypass patients: Correlation of blood clot stiffness with platelet integrin ?IIb?3 activity, aspirin usage, and transfusion risk.
26631735 2016 ?-Subunit Binding Is Sufficient for Ligands to Open the Integrin ?IIb?3 Headpiece.
26391523 2015 The Structure of a Full-length Membrane-embedded Integrin Bound to a Physiological Ligand.
26359510 2015 Ibrutinib Inhibits Platelet Integrin ?IIb?3 Outside-In Signaling and Thrombus Stability But Not Adhesion to Collagen.
26301697 2015 Immunodiagnosis of platelet activation in immune thrombocytopenia through scFv antibodies cognate to activated IIb3 integrins.
25827233 2015 ?IIb?3 variants defined by next-generation sequencing: predicting variants likely to cause Glanzmann thrombasthenia.
25632962 2015 Annular anionic lipids stabilize the integrin ?IIb?3 transmembrane complex.
25518511 2014 [Factors influencing platelet aggregation in patients with acute coronary syndrome].
More...