Property Summary

Ligand Count 6
NCBI Gene PubMed Count 379
PubMed Score 3309.79
PubTator Score 2637.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
osteosarcoma 7950 4.0e-06
pancreatic carcinoma 562 1.2e-03
pancreatic cancer 2398 1.2e-03
group 4 medulloblastoma 1855 3.8e-03
tuberculosis 2010 1.2e-02
gastric cancer 459 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 1.5e-02
group 4 medulloblastoma 1.100 3.8e-03
osteosarcoma -3.461 4.0e-06
pancreatic cancer 1.800 1.2e-03
pancreatic carcinoma 1.800 1.2e-03
tuberculosis 1.300 1.2e-02

Gene RIF (302)

AA Sequence

MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGA      1 - 70
PRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAP     71 - 140
WQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAG    141 - 210
ELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLN    211 - 280
TTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRAD    281 - 350
RKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV    351 - 420
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQ    421 - 490
LLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQA    491 - 560
GTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIV    561 - 630
LDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGF    631 - 700
ERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLD    701 - 770
VPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP    771 - 840
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVS    841 - 910
CDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEA    911 - 980
QVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE               981 - 1039
//

Text Mined References (386)

PMID Year Title