Property Summary

NCBI Gene PubMed Count 108
Grant Count 166
R01 Count 66
Funding $31,787,801.83
PubMed Score 836.35
PubTator Score 347.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Vitamin K deficiency hemorrhagic disease 11 5.708 2.9
Pseudoxanthoma Elasticum 19 4.671 2.3
Euthyroid sick syndrome 5 4.411 2.2
Kidney disease 396 4.315 2.2
Calcinosis 62 4.006 2.0
Hyperphosphatemia 32 3.722 1.9
Atherosclerosis 275 3.658 1.8
Osteoporosis 257 3.532 1.8
Hypothyroidism 89 3.525 1.8
Hyperthyroidism 50 3.445 1.7
Pain agnosia 99 3.26 1.6
Hyperthyroxinemia 9 3.192 1.6
diabetes mellitus 1,663 3.098 1.5
Bruxism 19 3.065 1.5
Glycogen storage disease VI 3 3.064 1.5
AORTIC VALVE DISEASE 1 2
Animal Mammary Neoplasms 136
Atopic dermatitis 944
Becker muscular dystrophy 187
Breast cancer 3,094
Duchenne muscular dystrophy 602
Keutel syndrome 1
Mammary Neoplasms, Experimental 150
Spontaneous abortion 108
Uremia 19
Varicosity 4
Vascular calcification 1
X-linked cerebral adrenoleukodystrophy 115
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
gastric carcinoma 832
glioblastoma 5,572
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
pterygium 74
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087

Expression

Synonym

Accession P08493 A0M8W5 B2R519 J3KMX7 Q2TU41 Q567P9 Q6ICN5 MGP
Symbols NTI
GIG36
MGLAP

Gene

MGP

Gene RIF (89)

PMID Text
26771974 Uncarboxylated MGP in synovial fluid might serve as a novel biomarker for assessing knee osteoarthritis progression.
26040031 The association has been found between the ischemic atherothrombotic stroke and polymorphic variants of genes MGP and VKORC1.
25990696 MGP expression is significantly lower in diseased relative to normal aortic valve interstitial cells. Lack of this important "anti-calcification" protein may contribute to calcification of the aortic valve.
25987667 High levels of desphospho-uncarboxylated MGP are independently and positively associated with arterial stiffness after adjustment for common cardiovascular risk factors, renal function, and age.
25974989 MGP expression is impaired in patients with ankylosing spondylitis
25957430 Data shoed increased GAS6 and decreased MGP levels in hemodialysis patients, as mediators of induction or prevention of vascular calcification.
25871831 Altering NOTCH1 levels affected MGP mRNA and protein.
25528106 Higher plasma dephosphorylated uncarboxylated MGP (reflective of lower vitamin K status) was associated with higher odds of meniscus damage, osteophytes, bone marrow lesions, and subarticular cysts.
25458708 It is assumed that Lp-PLA2 is involved in vascular calcification and that dp-ucMGP is a more appropriate biomarker of residual risk than Lp-PLA2 itself.
25421980 Inactive nonphosphorylated and uncarboxylated matrix Gla protein levels were followed in a Flemish population. They correlated causally with non-cancer mortality and coronary events but not total cardiovascular mortality.
More...

AA Sequence

MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPVHELNR      1 - 70
EACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK                                          71 - 103
//

Text Mined References (110)

PMID Year Title
27547048 2016 Matrix Gla protein in tumoral pathology.
27348051 2016 Matrix-Gla Protein rs4236 [A/G] gene polymorphism and serum and GCF levels of MGP in patients with subgingival dental calculus.
27172275 2016 Matrix-Gla protein promotes osteosarcoma lung metastasis and associates with poor prognosis.
27100101 2016 Plasma Desphospho-Uncarboxylated Matrix Gla Protein as a Marker of Kidney Damage and Cardiovascular Risk in Advanced Stage of Chronic Kidney Disease.
27009385 2016 Matrix Gla protein repression by miR-155 promotes oncogenic signals in breast cancer MCF-7 cells.
26981564 2016 Matrix Gla-Protein (MGP) Not Only Inhibits Calcification in Large Arteries But Also May Be Renoprotective: Connecting the Dots.
26771974 Attenuate Synovial Fluid Uncarboxylated Matrix Gla-Protein (ucMGP) Concentrations Are Linked with Radiographic Progression in Knee Psteoarthritis.
26618253 2016 The abnormal status of uncarboxylated matrix Gla protein species represents an additional mortality risk in heart failure patients with vascular disease.
26040031 2015 [Association of allelic polymorphisms of genes matrix Gla-protein system with ischemic atherothrombotic stroke].
26016598 2016 Desphospho-uncarboxylated matrix Gla protein is associated with increased aortic stiffness in a general population.
More...