Property Summary

NCBI Gene PubMed Count 108
PubMed Score 836.35
PubTator Score 347.22

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 4.09406623343288E-14
ovarian cancer 8492 8.27057754957817E-11
Duchenne muscular dystrophy 602 2.18784202694403E-9
lung carcinoma 2844 4.66883487980143E-9
juvenile dermatomyositis 1189 9.99443446447271E-9
sonic hedgehog group medulloblastoma 1482 2.51049038299945E-8
limb girdle muscular dystrophy 2A 156 3.38278354866153E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.12478881472956E-6
pituitary cancer 1972 2.46666075114987E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.5613687108362E-6
acute quadriplegic myopathy 1157 7.68316222416853E-6
lung adenocarcinoma 2714 1.32733025106283E-5
pancreatic cancer 2300 1.34352651469999E-5
Breast cancer 3099 2.71711369775572E-5
ulcerative colitis 2087 6.92984170057815E-5
primary pancreatic ductal adenocarcinoma 1271 1.60704852337253E-4
psoriasis 6685 1.7884808622403E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.60100359076042E-4
pilocytic astrocytoma 3086 6.61650685751175E-4
adrenocortical carcinoma 1427 9.10196028144415E-4
Atopic dermatitis 944 9.29931652694609E-4
adult high grade glioma 2148 0.00127113531499149
posterior fossa group A ependymoma 1511 0.00137954137404255
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00210759064334927
Becker muscular dystrophy 187 0.0034200328748081
interstitial lung disease 292 0.00357831360558695
pterygium 74 0.00631422357425399
glioblastoma 5572 0.00737001595234917
non primary Sjogren syndrome sicca 840 0.00928483695451288
medulloblastoma, large-cell 6234 0.0243014912926192
osteosarcoma 7933 0.0297674190229055
colon cancer 1475 0.0318227606370114
gastric carcinoma 832 0.0428871967031452
X-linked cerebral adrenoleukodystrophy 115 0.0460282205635189
Disease Target Count
Keutel syndrome 1



Accession P08493 A0M8W5 B2R519 J3KMX7 Q2TU41 Q567P9 Q6ICN5 MGP
Symbols NTI



  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (89)

26771974 Uncarboxylated MGP in synovial fluid might serve as a novel biomarker for assessing knee osteoarthritis progression.
26040031 The association has been found between the ischemic atherothrombotic stroke and polymorphic variants of genes MGP and VKORC1.
25990696 MGP expression is significantly lower in diseased relative to normal aortic valve interstitial cells. Lack of this important "anti-calcification" protein may contribute to calcification of the aortic valve.
25987667 High levels of desphospho-uncarboxylated MGP are independently and positively associated with arterial stiffness after adjustment for common cardiovascular risk factors, renal function, and age.
25974989 MGP expression is impaired in patients with ankylosing spondylitis
25957430 Data shoed increased GAS6 and decreased MGP levels in hemodialysis patients, as mediators of induction or prevention of vascular calcification.
25871831 Altering NOTCH1 levels affected MGP mRNA and protein.
25528106 Higher plasma dephosphorylated uncarboxylated MGP (reflective of lower vitamin K status) was associated with higher odds of meniscus damage, osteophytes, bone marrow lesions, and subarticular cysts.
25458708 It is assumed that Lp-PLA2 is involved in vascular calcification and that dp-ucMGP is a more appropriate biomarker of residual risk than Lp-PLA2 itself.
25421980 Inactive nonphosphorylated and uncarboxylated matrix Gla protein levels were followed in a Flemish population. They correlated causally with non-cancer mortality and coronary events but not total cardiovascular mortality.

AA Sequence

EACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK                                          71 - 103

Text Mined References (110)

PMID Year Title
27547048 2016 Matrix Gla protein in tumoral pathology.
27348051 2016 Matrix-Gla Protein rs4236 [A/G] gene polymorphism and serum and GCF levels of MGP in patients with subgingival dental calculus.
27172275 2016 Matrix-Gla protein promotes osteosarcoma lung metastasis and associates with poor prognosis.
27100101 2016 Plasma Desphospho-Uncarboxylated Matrix Gla Protein as a Marker of Kidney Damage and Cardiovascular Risk in Advanced Stage of Chronic Kidney Disease.
27009385 2016 Matrix Gla protein repression by miR-155 promotes oncogenic signals in breast cancer MCF-7 cells.
26981564 2016 Matrix Gla-Protein (MGP) Not Only Inhibits Calcification in Large Arteries But Also May Be Renoprotective: Connecting the Dots.
26771974 Attenuate Synovial Fluid Uncarboxylated Matrix Gla-Protein (ucMGP) Concentrations Are Linked with Radiographic Progression in Knee Psteoarthritis.
26618253 2016 The abnormal status of uncarboxylated matrix Gla protein species represents an additional mortality risk in heart failure patients with vascular disease.
26040031 2015 [Association of allelic polymorphisms of genes matrix Gla-protein system with ischemic atherothrombotic stroke].
26016598 2016 Desphospho-uncarboxylated matrix Gla protein is associated with increased aortic stiffness in a general population.