Property Summary

NCBI Gene PubMed Count 243
PubMed Score 76.58
PubTator Score 157.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
lung cancer -1.500 7.6e-05
Astrocytoma, Pilocytic 1.400 9.5e-03
Breast cancer 3.900 2.3e-02
breast carcinoma 1.900 1.5e-04
colon cancer 3.900 2.0e-04
cystic fibrosis -1.233 2.0e-05
ductal carcinoma in situ 2.200 4.3e-04
gastric carcinoma 3.500 4.2e-02
group 4 medulloblastoma -1.500 1.3e-02
head and neck cancer -1.500 4.8e-02
interstitial cystitis 1.300 1.9e-02
invasive ductal carcinoma 3.018 1.6e-03
lung adenocarcinoma -1.100 1.4e-06
lung carcinoma -1.100 4.8e-05
nasopharyngeal carcinoma 1.200 1.1e-02
ovarian cancer 2.600 1.8e-02
pancreatic cancer 2.500 1.0e-05
permanent atrial fibrillation -1.100 2.5e-02
primary pancreatic ductal adenocarcinoma 4.751 5.9e-05
primary Sjogren syndrome -1.400 1.5e-02
psoriasis -1.200 1.0e-04
tuberculosis -3.800 1.0e-06
ulcerative colitis 2.400 2.3e-03
X-linked cerebral adrenoleukodystrophy 2.700 6.1e-03

Protein-protein Interaction (2)

Gene RIF (190)

AA Sequence

MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK      1 - 70
RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEI     71 - 140
SKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKV    141 - 210
VDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAG    211 - 280
ADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYC    281 - 350
EGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV    351 - 420
EECGCS                                                                    421 - 426
//

Text Mined References (243)

PMID Year Title