Property Summary

NCBI Gene PubMed Count 230
Grant Count 27
R01 Count 18
Funding $3,238,502.85
PubMed Score 65.59
PubTator Score 157.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
permanent atrial fibrillation -1.100 0.025
group 4 medulloblastoma -2.600 0.000
cystic fibrosis 1.300 0.018
primary pancreatic ductal adenocarcinoma 4.751 0.000
tuberculosis -4.600 0.000
X-linked cerebral adrenoleukodystrophy 3.000 0.022
colon cancer 4.500 0.000
lung cancer -1.500 0.000
pancreatic cancer 4.500 0.001
breast carcinoma 2.600 0.000
Breast cancer 6.300 0.022
interstitial cystitis 4.100 0.000
lung adenocarcinoma -1.100 0.000
pilocytic astrocytoma 1.700 0.010
primary Sjogren syndrome -1.400 0.015
invasive ductal carcinoma 3.686 0.001
nasopharyngeal carcinoma 2.500 0.000
psoriasis -1.200 0.000
lung carcinoma -1.100 0.000
gastric carcinoma 4.800 0.013
ductal carcinoma in situ 2.900 0.000
ulcerative colitis 4.500 0.000
ovarian cancer 2.800 0.003
head and neck cancer -1.500 0.048

Gene RIF (177)

PMID Text
26563344 Data show that dedifferentiated chondrocytes can be redifferentiated following treatment with the chimeric erythroid differentiation factor (activin A)/bone morphogenetic protein 2 (BMP2) ligand AB235.
26447543 we show a role for autocrine Activin signaling in the regulation of colony formation, cell migration and invasion in Barrett's tumorigenesis.
26415587 Study shows that INHBA and FST are induced by seminal fluid in cervical tissues and thus, may contribute to regulation of the post-coital response in women.
26317418 Overexpression of activin A in OSCCs, which is controlled by downregulation of miR-143/miR-145 cluster, regulates apoptosis, proliferation and invasiveness, and it is clinically correlated with lymph node metastasis and poor survival.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26096938 Inhibin betaA is translationally regulated by TGFbeta via hnRNP E1.
26047946 Activin A inhibited signaling by BMP-6 and BMP-9 by competing for type 2 receptors ACVR2A and ACVR2B.
25833251 able to restore glucose-stimulated insulin secretion in islets from type 2 diabetic donors
25796148 Low activin-A expression was correlated with the occurrence, development, metastasis and malignant degree of lung adenocarcinoma.
25751105 our study suggests that increased circulating concentrations of ActA may contribute to the development of cachexia in cancer patients.
More...

AA Sequence

MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK      1 - 70
RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEI     71 - 140
SKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKV    141 - 210
VDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAG    211 - 280
ADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYC    281 - 350
EGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV    351 - 420
EECGCS                                                                    421 - 426
//

Text Mined References (230)

PMID Year Title
26563344 2015 Activin A/BMP2 chimera AB235 drives efficient redifferentiation of long term cultured autologous chondrocytes.
26447543 2015 Activin a signaling regulates cell invasion and proliferation in esophageal adenocarcinoma.
26415587 2015 Seminal fluid factors regulate activin A and follistatin synthesis in female cervical epithelial cells.
26317418 2015 Low miR-143/miR-145 Cluster Levels Induce Activin A Overexpression in Oral Squamous Cell Carcinomas, Which Contributes to Poor Prognosis.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26096938 2016 Translational regulation of inhibin ?A by TGF? via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells.
26047946 2015 Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B.
25833251 2014 Effects of activin A on survival, function and gene expression of pancreatic islets from non-diabetic and diabetic human donors.
25804741 2015 Activin A directs striatal projection neuron differentiation of human pluripotent stem cells.
25796148 2015 Expression of Cripto-1 gene protein and Activin-A in human lung adenocarcinoma tissue.
More...