Property Summary

NCBI Gene PubMed Count 265
Grant Count 607
R01 Count 166
Funding $178,724,908.77
PubMed Score 4179.22
PubTator Score 2454.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Cancer 2,346 6.358 3.2
Alzheimer's disease 644 4.914 2.5
Hypertension 287 4.51 2.3
Endometriosis 535 4.23 2.1
Congestive heart failure 30 4.14 2.1
Oxyphilic adenoma 21 3.82 1.9
Leiomyoma 25 3.76 1.9
Pain agnosia 99 3.703 1.9
Renal oncocytoma 22 3.696 1.8
Nephrogenic adenoma 10 3.667 1.8
Angioedema 36 3.534 1.8
Kidney disease 396 3.475 1.7
Cystic nephroma 3 3.425 1.7
Anemia 252 3.392 1.7
Macroglobulinemia 17 3.366 1.7
Angiomyolipoma 17 3.306 1.7
Adenofibroma 5 3.239 1.6
Myoepithelioma 12 3.221 1.6
Diarrhea 155 3.213 1.6
Endometrial stromal nodule 8 3.182 1.6
Adenoma 165 3.176 1.6
Acute diarrhea 2
Autosomal dominant cerebellar ataxia 34 4.0
Breast cancer 3,094
Carcinoma 2,147 1.0
Charcot-Marie-Tooth disease 74 4.0
Chronic heart failure 46
Cryopyrin-Associated Periodic Syndromes 2
Diabetic Neuropathies 13
Liver Cirrhosis, Experimental 108
Lung Injury 20
Mammary Neoplasms 410
Neurodegenerative disease 383 4.0
Neuropathy 210 4.0
Prostatic Neoplasms 471
Renal Insufficiency 10
acute myeloid leukemia 780
acute quadriplegic myopathy 1,157
axial spondyloarthropathy 28
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
facioscapulohumeral dystrophy 286
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
non-small cell lung carcinoma 413
osteosarcoma 7,933
periodontitis 269
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (21)

Disease log2 FC p
urothelial carcinoma -2.800 0.023
malignant mesothelioma 1.700 0.000
cutaneous lupus erythematosus 2.500 0.001
osteosarcoma -1.791 0.010
cystic fibrosis 5.656 0.000
periodontitis 1.600 0.000
acute quadriplegic myopathy 1.034 0.002
non-small cell lung carcinoma -2.700 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.003
lung cancer 2.300 0.000
colon cancer 2.800 0.042
breast carcinoma -2.300 0.000
lung adenocarcinoma -2.800 0.000
Breast cancer -4.600 0.000
lung carcinoma -2.300 0.000
ductal carcinoma in situ -3.100 0.000
invasive ductal carcinoma -4.200 0.000
acute myeloid leukemia -1.400 0.008
ulcerative colitis 2.400 0.000
axial spondyloarthropathy 1.300 0.036
facioscapulohumeral dystrophy -1.800 0.008

Synonym

Accession P08473 A8K6U6 D3DNJ9 Q3MIX4
Symbols NEP
SFE
CD10
CALLA
CMT2T
SCA43

Gene

MME

PANTHER Protein Class (3)

PDB

1DL9   1DMT   1QVD   1R1H   1R1I   1R1J   1Y8J   2QPJ   2YB9   4CTH   5JMY  

Gene RIF (233)

PMID Text
27096746 The peptide qf-Abeta(12-18)C (sequence VHHQKLVC) was cleaved by multiple Abeta-degrading enzymes, including NEP, ACE, and ECE-1, whereas the redesigned peptide qf-Abeta(12-16)AAC (sequence VHHQKAAC) was sensitive to NEP and ACE only.
26991897 Loss-of-function MME mutations are the most frequent cause of adult-onset autosomal-recessive Charcot-Marie-Tooth disease type 2 in Japan.
26881775 These findings indicate that CD10 may promote tumor progression by regulating the expression profiles of genes related to cell proliferation, angiogenesis, and resistance to apoptosis.
26830028 Case Report: endometrial mixed carcinoma with the neuroendocrine component expressing CD10 that showed a long survival.
26609034 This study reveals some unusual findings in otherwise classical disease entity, like absence of palpable spleen, presence of lymphadenopathy, normal or elevated leukocyte counts, expression of CD10, which at times could be diagnostically challenging.
26573127 CD10 and Bcl2 expression in tumor cells could give convincing diagnostic value to distinguish squamous cell carcinoma from seborrheic keratosis
26562027 CD10 positivity is luminal/membranous in most benign apocrine breast lesions, the staining being nonuniversal and sometimes focal; analogous staining in apocrine malignancies seems rarer in DCIS and even rarer in invasive apocrine carcinomas, but atypical cytoplasmic positivity may also occur
26414904 CD10 gene expression plays a role in the pathogenesis of diffuse large B-cell lymphoma.
26141216 In stage I lung adenocarcinoma, tumoral CD10 correlated with high-grade histology and was an independent predictor of recurrence in intermediate-grade tumors.
26124315 CD10 expression is related to a distinct gene expression signature in mantle cell lymphoma cases, but is without clinical or biological implications.
More...

AA Sequence

MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI      1 - 70
QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY     71 - 140
RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK    141 - 210
NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE    211 - 280
KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE    281 - 350
YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME    351 - 420
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND    421 - 490
NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL    491 - 560
QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS    561 - 630
WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP    631 - 700
EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW                        701 - 750
//

Text Mined References (269)

PMID Year Title
27588448 2016 Rare Variants in MME, Encoding Metalloprotease Neprilysin, Are Linked to Late-Onset Autosomal-Dominant Axonal Polyneuropathies.
27096746 2016 Design of Peptide Substrate for Sensitively and Specifically Detecting Two A?-Degrading Enzymes: Neprilysin and Angiotensin-Converting Enzyme.
26991897 2016 Mutations in MME cause an autosomal-recessive Charcot-Marie-Tooth disease type 2.
26881775 2016 CD10-Equipped Melanoma Cells Acquire Highly Potent Tumorigenic Activity: A Plausible Explanation of Their Significance for a Poor Prognosis.
26830028 2016 CD10 expression in the neuroendocrine carcinoma component of endometrial mixed carcinoma: association with long survival.
26609034 2015 Haematological profile of 21 patients with hairy cell leukaemia in a tertiary care centre of north India.
26573127 2015 Diagnostic value of CD10 and Bcl2 expression in distinguishing cutaneous basal cell carcinoma from squamous cell carcinoma and seborrheic keratosis.
26562027 2015 CD10 Immunohistochemical Expression in Apocrine Lesions of the Breast.
26414904 2016 CD10, BCL6, and MUM1 expression in diffuse large B-cell lymphoma on FNA samples.
26141216 2015 Tumoral CD10 expression correlates with high-grade histology and increases risk of recurrence in patients with stage I lung adenocarcinoma.
More...