Property Summary

NCBI Gene PubMed Count 107
PubMed Score 588.52
PubTator Score 390.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Porphyria, Acute Intermittent 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Porphyria 10 0.0 5.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 2.8e-03
atypical teratoid / rhabdoid tumor 1.200 5.0e-09
ependymoma -1.600 2.5e-03
glioblastoma 1.100 1.4e-04
lung adenocarcinoma 1.100 4.2e-13
lung cancer 1.400 2.4e-03
malignant mesothelioma 1.200 4.9e-06
medulloblastoma, large-cell 1.600 9.4e-06
oligodendroglioma -1.700 1.4e-03
osteosarcoma -4.004 4.1e-09
psoriasis 1.100 2.1e-03

Gene RIF (48)

AA Sequence

MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSK      1 - 70
IGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEK     71 - 140
SVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEE    141 - 210
CMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTG    211 - 280
GVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNI    281 - 350
LDVARQLNDAH                                                               351 - 361
//

Text Mined References (116)

PMID Year Title