Property Summary

NCBI Gene PubMed Count 54
Grant Count 36
R01 Count 12
Funding $4,375,959.25
PubMed Score 242.32
PubTator Score 59.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.258 0.010

Gene RIF (44)

PMID Text
26039424 this current study provides substantial evidence that genetic polymorphisms of rs3805322 in the ADH4 gene may be associated with an increased risk of developing ESCC in two Chinese Han populations.
24469609 This study confirmed the genetic heterogeneity of cluster headache, suggesting that mutations in the ADH4 gene might be related to cluster headache in a subset of cases.
24051444 The serum expression of ADH4 protein correlates with the progression of esophageal cancer.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
22232963 Our results suggest that the analysed polymorphisms ofANKK1 and ADH4 can play an important part in the pathogenesis of alcohol abuse
22147505 expression levels of ADH4 mRNA and protein have found to be markedly reduced in hepatocellular carcinoma (HCC) tissues and significantly associated with survival.
22044940 data suggest that ADH4 intronic variants play a role in alcohol dependence susceptibility in Italian populations
21635275 Variants in the ADH1B and ADH4 genes may be protective against the development of some symptoms associated with alcohol dependence.
21480392 Data indicate that further studies of EPHX1 rs1051740, ADH4 r1042364, and NQO1 rs291766 are needed to make more definitive conclusion on the role of variation in xenobiotic metabolism in ovarian cancer.
21184752 the high catalytic activity of human alcohol dehydrogenase 4 studied with horse liver ADH1E
More...

AA Sequence

MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHE      1 - 70
AAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKG     71 - 140
KPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVG    141 - 210
LSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET    211 - 280
MKAALDCTTAGWGSCTFIGVAAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDA    281 - 350
LVTHTLPFDKISEAFDLMNQGKSVRTILIF                                            351 - 380
//

Text Mined References (57)

PMID Year Title
26039424 2015 Impact of alcohol dehydrogenase gene 4 polymorphisms on esophageal squamous cell carcinoma risk in a Chinese population.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24469609 2015 Molecular analysis of cluster headache.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24051444 2013 The alcohol dehydrogenase isoenzyme (ADH IV) as a candidate tumour marker of esophageal cancer.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22232963 [Research on associations between selected polymorphisms of genes DRD2, 5HTT, GRIK3, ADH4 and alcohol dependence syndrome].
22147505 2012 Identification of ADH4 as a novel and potential prognostic marker in hepatocellular carcinoma.
More...