Property Summary

Ligand Count 69
NCBI Gene PubMed Count 118
PubMed Score 834.30
PubTator Score 655.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (7)

Gene RIF (58)

AA Sequence

MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNI      1 - 70
NVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGT     71 - 140
LCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNV    141 - 210
AHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL                             211 - 255
//

Text Mined References (122)

PMID Year Title