Property Summary

NCBI Gene PubMed Count 112
Grant Count 210
R01 Count 118
Funding $22,819,134.17
PubMed Score 822.62
PubTator Score 655.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08311 Q6IBJ6 Q9UCA5 Q9UCU6 CG
Symbols CG
CATG

Gene

PANTHER Protein Class (3)

PDB

1AU8   1CGH   1KYN   1T32  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
581 screening 96 / 0 / 62009 Cathepsin G
832 confirmatory 69 / 2 / 22 Cathepsin G dose-response confirmation

Gene RIF (55)

PMID Text
26986619 Data show that lactoferrin (LF) increases the catalytic activity of cathepsin G (CatG) at physiological concentration.
26837514 CatG is an essential protease for regulating MHC I molecules
26270939 Patients with certain polymorphisms in the CTSG gene had lower risk for chronic postsurgical pain compared with wild-types.
25248056 expression levels of ELANE and CTSG were determined by quantitative real-time PCR
24929239 These in vivo data provide, for the first time, compelling evidence of the collateral involvement of cathepsin G, NE, and proteinase 3 in cigarette smoke-induced tissue damage and emphysema
24877096 Elastase and cathepsin G are elevated in the plasma of HD patients, originating from primed PMNLs. In these patients, chronic elevation of these enzymes contributes to cleavage of VE-cadherin and possible disruption of endothelial integrity.
24532668 proteolytic cleavage of PLTP by cathepsin G may enhance the injurious inflammatory responses that occur in COPD
23940756 Neutrophil cathepsin G is a physiologic modulator of platelet thrombus formation in vivo and has potential as a target for novel anti-thrombotic therapies.
23466190 Increased concentrations of cathepsins B, D and G in the proliferative eutopic endometrium may play a role in the implantation of endometrial tissue outside the uterine cavity.
23454598 demonstrate that cathepsin G (CG), neutrophil elastase (NE), and to a lesser extent proteinase 3 (PR3), degrade endocan
More...

AA Sequence

MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNI      1 - 70
NVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGT     71 - 140
LCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNV    141 - 210
AHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL                             211 - 255
//

Text Mined References (117)

PMID Year Title
26986619 2016 Lactoferrin Is an Allosteric Enhancer of the Proteolytic Activity of Cathepsin G.
26837514 2016 Cathepsin G-mediated proteolytic degradation of MHC class I molecules to facilitate immune detection of human glioblastoma cells.
26270939 2015 Up-regulation of Cathepsin G in the Development of Chronic Postsurgical Pain: An Experimental and Clinical Genetic Study.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25248056 Quantitative analysis of elastase and cathepsin G mRNA levels in peripheral blood CD14(+) cells from patients with rheumatoid arthritis.
24929239 2014 Unopposed cathepsin G, neutrophil elastase, and proteinase 3 cause severe lung damage and emphysema.
24877096 2014 Elastase and cathepsin G from primed leukocytes cleave vascular endothelial cadherin in hemodialysis patients.
24532668 2014 Cathepsin G degradation of phospholipid transfer protein (PLTP) augments pulmonary inflammation.
23940756 2013 Cathepsin G-dependent modulation of platelet thrombus formation in vivo by blood neutrophils.
More...