Property Summary

NCBI Gene PubMed Count 162
Grant Count 294
R01 Count 129
Funding $47,556,444.31
PubMed Score 488.47
PubTator Score 326.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.400 0.000
non-small cell lung cancer -1.318 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.004
intraductal papillary-mucinous neoplasm ... -1.100 0.014
lung cancer -2.200 0.000
breast carcinoma -2.600 0.000
fibroadenoma -2.400 0.003
lung adenocarcinoma -1.100 0.003
invasive ductal carcinoma -2.500 0.001
lung carcinoma 1.600 0.000
ductal carcinoma in situ -1.900 0.000

Synonym

Accession P08294 Q5U781 Q6FHA2 EC-SOD
Symbols EC-SOD

Gene

PANTHER Protein Class (1)

PDB

2JLP  

Gene RIF (150)

PMID Text
26006040 Extracellular superoxide dismutase ameliorates streptozotocin-induced rat diabetic nephropathy via inhibiting the ROS/ERK1/2 signaling.
25894370 ECSOD Ala40Thr polymorphism, a significant association was observed between this polymorphism and HCC risk in non-hepatitis B virus (HBV) carriers but not in HBV carriers
25855220 The T-allele of rs2284659 in the promoter of SOD3 was associated with better cardiovascular outcomes in diabetic patients.
25751262 SOD3 regulates the expression of multiple components of small G protein GTPase signal pathways.
25749103 Expression of extracellular superoxide dismutase (EC-SOD) and expression of the prooxidant gene NADPH oxidase 4 was decreased significantly by trichostatin A.
25634994 These results support the hypothesis that loss of extracellular SOD contributes to the invasive phenotype of pancreatic ductal adenocarcinoma
25496033 FXR may regulate SOD3 expression to suppress reactive oxygen species production, resulting in decreasing JNK activity.
25358638 Sod3 is a critical mediator of VEGF-C-induced breast cancer metastasis.
25332062 The combination of serum S100A9, SOD3, and MMP9 levels could achieve 92.5% sensitivity and 95% specificity to discriminate between pulmonary tuberculosis and healthy controls.
25130429 The treatment with E2 suppressed, whereas VC and Res prevented E2-mediated decrease in the expression levels of SOD3, NQO1, Nrf2 mRNA, and protein in MCF-10A cells
More...

AA Sequence

MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSAT      1 - 70
LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP     71 - 140
QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV    141 - 210
GVCGPGLWERQAREHSERKKRRRESECKAA                                            211 - 240
//

Text Mined References (164)

PMID Year Title
26006040 2015 Extracellular superoxide dismutase ameliorates streptozotocin-induced rat diabetic nephropathy via inhibiting the ROS/ERK1/2 signaling.
25894370 2015 Genetic polymorphisms in antioxidant enzyme genes and susceptibility to hepatocellular carcinoma in Chinese population: a case-control study.
25855220 2015 Plasma extracellular superoxide dismutase concentration, allelic variations in the SOD3 gene and risk of myocardial infarction and all-cause mortality in people with type 1 and type 2 diabetes.
25751262 2015 Extracellular superoxide dismutase regulates the expression of small gtpase regulatory proteins GEFs, GAPs, and GDI.
25749103 2015 Regulation of Oxidative Stress in Pulmonary Artery Endothelium. Modulation of Extracellular Superoxide Dismutase and NOX4 Expression Using Histone Deacetylase Class I Inhibitors.
25644107 2015 Extracellular Superoxide Dismutase Protects against Proteinuric Kidney Disease.
25634994 2015 Loss of SOD3 (EcSOD) Expression Promotes an Aggressive Phenotype in Human Pancreatic Ductal Adenocarcinoma.
25496033 2015 Farnesoid X receptor antagonizes JNK signaling pathway in liver carcinogenesis by activating SOD3.
25416956 2014 A proteome-scale map of the human interactome network.
25358638 2014 Vascular endothelial growth factor C promotes breast cancer progression via a novel antioxidant mechanism that involves regulation of superoxide dismutase 3.
More...