Property Summary

NCBI Gene PubMed Count 173
PubMed Score 502.01
PubTator Score 326.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -2.600 2.0e-05
ductal carcinoma in situ -1.900 3.0e-04
fibroadenoma -2.400 2.9e-03
intraductal papillary-mucinous adenoma (... -1.100 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
invasive ductal carcinoma -1.101 2.3e-02
lung adenocarcinoma -1.100 2.5e-03
lung cancer -2.200 5.5e-05
lung carcinoma 1.600 5.9e-09
non-small cell lung cancer -1.318 5.6e-12
psoriasis -1.400 1.8e-07

 OMIM Phenotype (1)

Gene RIF (158)

AA Sequence

MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSAT      1 - 70
LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP     71 - 140
QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV    141 - 210
GVCGPGLWERQAREHSERKKRRRESECKAA                                            211 - 240
//

Text Mined References (175)

PMID Year Title