Property Summary

NCBI Gene PubMed Count 189
Grant Count 43
R01 Count 34
Funding $1,748,650.33
PubMed Score 235.64
PubTator Score 287.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (173)

PMID Text
26552558 The frequency of GSTA1, GSTM1 and GSTP1 genotypes was not significantly different between progressive myoclonus epilepsy patients and controls
26419450 this is the first population pharmacokinetic study to suggest that GSTA1 polymorphisms in adults are associated with busulfan pharmacokinetics
26321410 GSTA1 polymorphism is associated with different pregnancy-related conditions
26222310 Patients with a GSTA1*A heterozygous variant had a lower exposure to 4-hydroxycyclophosphamide (4OHCTX) during cyclophosphamide treatment of lupus nephritis compared to wild-type patients.
25867434 Data show that the distribution of the glutathione S-transferases alleles GSTA1*A/*B and GSTP1*A, *B, and *C in the Polish population correspond to the results of studies in Caucasians.
25778330 Review/Meta-analysis: suggest that GSTA1 BB genotype was a risk factor for colorectal cancer, especially in Caucasian populations.
25730183 the differences of PK in BU among different ethnic groups existed because of the different distribution frequencies of GST gene polymorphism in Chinese patients and Caucasian patients.
25565670 GST genotyping before hematopoietic stem cell transplantation may allow better prediction of busulfan pharmacokinetics and drug toxicity, and thereby improve outcome after busulfan and cyclophosphamide conditioning
25374180 Our data indicated that GSTA1 expression may be a target molecule in early diagnosis and treatment of lung cancer
25251951 The distribution of genotype frequencies of the polymorphism GSTA1 was statistically different between cases and controls, and the presence of genotypes A / B and B / B suggests a protective role against the risk of PCa compared to genotype A / A.
More...

AA Sequence

MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (191)

PMID Year Title
26552558 2015 GSTA1, GSTM1, GSTP1 and GSTT1 polymorphisms in progressive myoclonus epilepsy: A Serbian case-control study.
26419450 2015 Population pharmacokinetics and pharmacodynamics of busulfan with GSTA1 polymorphisms in patients undergoing allogeneic hematopoietic stem cell transplantation.
26321410 2015 GSTA1 gene variation associated with gestational hypertension and its involvement in pregnancy-related pathogenic conditions.
26222310 2015 The GSTA1 polymorphism and cyclophosphamide therapy outcomes in lupus nephritis patients.
25867434 2015 Polymorphisms and allele frequencies of glutathione S-transferases A1 and P1 genes in the Polish population.
25778330 Polymorphisms of GSTA1 contribute to elevated cancer risk: evidence from 15 studies.
25730183 2015 Once-daily i.v. BU-based conditioning regimen before allogeneic hematopoietic SCT: a study of influence of GST gene polymorphisms on BU pharmacokinetics and clinical outcomes in Chinese patients.
25565670 2015 Glutathione Transferase Gene Variants Influence Busulfan Pharmacokinetics and Outcome After Myeloablative Conditioning.
25374180 2014 Expression and function of GSTA1 in lung cancer cells.
25251951 Human glutathione S-transferase polymorphisms associated with prostate cancer in the Brazilian population.
More...