Property Summary

NCBI Gene PubMed Count 609
Grant Count 301
R01 Count 213
Funding $26,194,102.25
PubMed Score 1694.30
PubTator Score 1264.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cystic fibrosis 3.549 0.000
periodontitis 1.100 0.000
non-small cell lung cancer 2.195 0.000
colon cancer 3.200 0.000
fibroadenoma 1.400 0.028
interstitial cystitis 6.500 0.000
nasopharyngeal carcinoma 1.700 0.011
inflammatory breast cancer 1.600 0.029
ductal carcinoma in situ 3.000 0.000
ulcerative colitis 6.800 0.000
psoriasis 1.100 0.000

Synonym

Accession P08254 B2R8B8 Q3B7S0 Q6GRF8 SL-1
Symbols SL-1
STMY
STR1
CHDS6
MMP-3
STMY1

Gene

PDB

1OO9   1UEA   1B3D   1B8Y   1BIW   1BM6   1BQO   1C3I   1C8T   1CAQ   1CIZ   1CQR   1D5J   1D7X   1D8F   1D8M   1G05   1G49   1G4K   1HFS   1HY7   1M1W   1QIA   1QIC   1SLM   1SLN   1UMS   1UMT   1USN   2D1O   2JNP   2JT5   2JT6   2SRT   2USN   3OHL   3OHO   3USN   4DPE   4G9L   4JA1  

Gene RIF (647)

PMID Text
27145630 the G allele and AG genotype of MMP-3 E45K polymorphism is associated with increased risk of osteosarcoma in adolescent population of Turkey.
27129069 The MMP-3-1612 5A/6A polymorphism may effect serum MMP-3 level and over-expression of serum MMP-3 level may be a risk factor for DVT formation.
27089651 MMP-3 level was shown to be useful as a disease activity marker in rheumatoid arthritis patients
27061553 Our results demonstrated that MMP-3 expression is deregulated in osteosarcomas
26863055 MMP3 is released from the synovial membrane under inflammatory conditions and may serve as biological markers for inflammatory osteoarthritis.
26853425 This study showed an increased frequency of heterozygotes for stromelysin-1 rs3025058 and thought to be involved in the etiology of Gastric cancer
26850593 These results indicate an essential role for MAPKs in the induction of MMP-3 in synovial sarcoma cells, through AP-1 activation.
26805660 Elevated levels of MMP-3 are associated with an increased risk of long-term MI in patients with and without ACS referred for coronary angiography.
26713439 MMP-3 Is an Endogenous Activator of the MMP-9 Secreted by Placental Leukocytes: Implication in Human Labor
26712881 MMP-3 polymorphism has a significant association with the risk of developing morbidity after acute myocardial infarction.
More...

AA Sequence

MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKF      1 - 70
LGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKV     71 - 140
WEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGT    141 - 210
NLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPV    211 - 280
PPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKD    281 - 350
LVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP    351 - 420
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC                 421 - 477
//

Text Mined References (610)

PMID Year Title
27145630 2016 MMP-3 gene polymorphisms and Osteosarcoma.
27129069 2016 MMP-3-1612 polymorphism--a risk factor for deep venous thrombosis formation.
27089651 2015 [MMP-3 as a Biomarker of Disease Activity of Rheumatoid Arthritis].
27061553 Elevated expression of matrix metalloproteinase-3 in human osteosarcoma and its association with tumor metastasis.
26863055 2015 Synovitis biomarkers: ex vivo characterization of three biomarkers for identification of inflammatory osteoarthritis.
26853425 Heterozygosity of stromelysin-1 (rs3025058) promoter polymorphism is associated with gastric cancer.
26850593 2016 Essential role of mitogen-activated protein kinases in IL-17A-induced MMP-3 expression in human synovial sarcoma cells.
26805660 2016 Usefulness of Plasma Matrix Metalloproteinase-3 Levels to Predict Myocardial Infarction in Men With and Without Acute Coronary Syndrome.
26713439 2015 Matrix Metalloproteinase-3 (MMP-3) Is an Endogenous Activator of the MMP-9 Secreted by Placental Leukocytes: Implication in Human Labor.
26712881 2016 Matrix Metalloproteinase 3 Gene Polymorphism and Its Level Predict Morbidity After Acute Myocardial Infarction.
More...