Property Summary

NCBI Gene PubMed Count 68
PubMed Score 2697.25
PubTator Score 1541.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 6.02401767105634E-53
astrocytoma 1493 2.20816250503269E-23
oligodendroglioma 2849 2.52251444793076E-19
posterior fossa group B ependymoma 1530 3.51974127169677E-16
glioblastoma 5572 9.90654385710046E-12
atypical teratoid/rhabdoid tumor 1095 6.7896895631449E-11
pediatric high grade glioma 2712 2.70589659253245E-8
pilocytic astrocytoma 3086 4.63659419203063E-8
sonic hedgehog group medulloblastoma 1482 8.87982417870369E-6
primitive neuroectodermal tumor 3031 5.17333073421508E-4
Pick disease 1893 9.9008171304309E-4
adrenocortical carcinoma 1427 0.0217004535888823
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0

Expression

  Differential Expression (13)

Synonym

Accession P08247 B2R7L6 B7Z359 Q6P2F7
Symbols MRX96
MRXSYP

Gene

SYP

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (38)

PMID Text
26604067 Study reveals the presence of two selected neuronal markers, MAP-2 and SYP mRNAs and protein expression, in eutopic endometrium and in endometriotic lesions.
26204769 Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development.
26022451 Anomalous expression of all intermediate filament proteins and synaptophysin was found in significant subsets of malignant melanoma.
25613139 Creatine inhibits HIV-1 Tat-induced downregulation of synaptophysin in neuron cells
25410733 Docosahexaenoic acid-containing phosphatidylcholines and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
24927707 This study demonstrated that synaptophysin was significantly lower in Down syndrome with Alzheimer disease compared with Down syndrome alone and similar to sporadic Alzheimer disease.
23763443 The paucity or absence of synaptophysin-positive cells in all three phenotypes of Barrett's mucosa might mirror a sequela of chronic inflammation caused by the particular pathogenic bacteria present in the immediate oesophageal microenvironment.
23726717 The results of this study suggested that SYP may be primarily associated with ADHD-I and its genetic mechanism may be gender-specific.
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23292839 the author showed that, in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low
More...

AA Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVE      1 - 70
FEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPM     71 - 140
LDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFL    141 - 210
NLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ    211 - 280
PAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM                                         281 - 313
//

Text Mined References (70)

PMID Year Title
26604067 2016 Expression of microtubule associated protein 2 and synaptophysin in endometrium: high levels in deep infiltrating endometriosis lesions.
26204769 [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].
26022451 2015 Aberrant intermediate filament and synaptophysin expression is a frequent event in malignant melanoma: an immunohistochemical study of 73 cases.
25410733 2014 DHA-PC and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
24927707 2014 Synaptophysin and synaptojanin-1 in Down syndrome are differentially affected by Alzheimer's disease.
23763443 2013 Paucity of synaptophysin-expressing cells in Barrett's mucosa.
23726717 2013 Association between SYP with attention-deficit/hyperactivity disorder in Chinese Han subjects: differences among subtypes and genders.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23292839 2013 Expression of NCAM (CD56), chromogranin A, synaptophysin, c-KIT (CD117) and PDGFRA in normal non-neoplastic skin and basal cell carcinoma: an immunohistochemical study of 66 consecutive cases.
23242284 2013 Synaptic proteins and choline acetyltransferase loss in visual cortex in dementia with Lewy bodies.
More...