Property Summary

NCBI Gene PubMed Count 72
PubMed Score 2821.72
PubTator Score 1541.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (13)

Disease log2 FC p
subependymal giant cell astrocytoma -2.082 2.0e-02
adrenocortical carcinoma 1.276 2.2e-02
adult high grade glioma -2.500 1.1e-05
astrocytic glioma -1.500 2.6e-03
Astrocytoma, Pilocytic -1.900 6.0e-08
atypical teratoid / rhabdoid tumor -2.400 2.6e-09
ependymoma -1.800 1.4e-02
glioblastoma -2.500 9.9e-12
group 3 medulloblastoma -1.500 4.6e-03
lung carcinoma 2.900 6.0e-53
oligodendroglioma -1.500 2.5e-19
Pick disease -1.700 9.9e-04
primitive neuroectodermal tumor -1.600 5.2e-04

Gene RIF (42)

AA Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVE      1 - 70
FEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPM     71 - 140
LDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFL    141 - 210
NLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ    211 - 280
PAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM                                         281 - 313
//

Text Mined References (75)

PMID Year Title