Property Summary

NCBI Gene PubMed Count 68
Grant Count 309
R01 Count 167
Funding $31,587,618.85
PubMed Score 2697.25
PubTator Score 1541.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (48)

Disease Z-score Confidence
Cancer 2,346 5.88 2.9
Alzheimer's disease 644 5.344 2.7
Ganglioglioma 16 5.004 2.5
Dysembryoplastic neuroepithelial tumor 10 4.614 2.3
Dementia 129 4.279 2.1
Adenoma 165 4.124 2.1
Brain disease 83 4.122 2.1
Melanotic neuroectodermal tumor 7 3.951 2.0
Toxic encephalopathy 131 3.756 1.9
Schizophrenia 501 3.718 1.9
Adrenal cortical adenoma 10 3.656 1.8
subependymal giant cell astrocytoma 2,287 3.598 1.8
Breast neuroendocrine neoplasm 2 3.494 1.7
Clear cell ependymoma 4 3.446 1.7
Cerebrovascular disease 231 3.445 1.7
Papillary ependymoma 2 3.414 1.7
Hemangioma 35 3.379 1.7
Eye disease 55 3.351 1.7
Cushing's syndrome 47 3.302 1.7
Myxopapillary ependymoma 4 3.281 1.6
Sertoli cell tumor 9 3.274 1.6
Middle ear adenoma 3 3.214 1.6
Pituitary adenoma 35 3.173 1.6
Gastrointestinal system disease 50 3.169 1.6
Cellular ependymoma 1 3.15 1.6
Parkinson's disease 364 3.149 1.6
Ampulla of vater neoplasm 1 3.023 1.5
Papilloma 27 3.003 1.5
CEROID LIPOFUSCINOSIS, NEURONAL, 6 7
Ceroid lipofuscinosis, neuronal 1, infan... 10 
Intellectual disability 573 4.0
Learning Disorders 27
MENTAL RETARDATION, X-LINKED 96 1
Memory Disorders 36
Mental Retardation, X-Linked 22
Pick disease 1,893
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid/rhabdoid tumor 1,095
glioblastoma 5,572
lung carcinoma 2,844
non-small cell lung carcinoma 413
oligodendroglioma 2,849
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482

Expression

  Differential Expression (13)

Synonym

Accession P08247 B2R7L6 B7Z359 Q6P2F7
Symbols MRX96
MRXSYP

Gene

SYP

Gene RIF (38)

PMID Text
26604067 Study reveals the presence of two selected neuronal markers, MAP-2 and SYP mRNAs and protein expression, in eutopic endometrium and in endometriotic lesions.
26204769 Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development.
26022451 Anomalous expression of all intermediate filament proteins and synaptophysin was found in significant subsets of malignant melanoma.
25613139 Creatine inhibits HIV-1 Tat-induced downregulation of synaptophysin in neuron cells
25410733 Docosahexaenoic acid-containing phosphatidylcholines and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
24927707 This study demonstrated that synaptophysin was significantly lower in Down syndrome with Alzheimer disease compared with Down syndrome alone and similar to sporadic Alzheimer disease.
23763443 The paucity or absence of synaptophysin-positive cells in all three phenotypes of Barrett's mucosa might mirror a sequela of chronic inflammation caused by the particular pathogenic bacteria present in the immediate oesophageal microenvironment.
23726717 The results of this study suggested that SYP may be primarily associated with ADHD-I and its genetic mechanism may be gender-specific.
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23292839 the author showed that, in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low
More...

AA Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVE      1 - 70
FEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPM     71 - 140
LDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFL    141 - 210
NLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ    211 - 280
PAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM                                         281 - 313
//

Text Mined References (70)

PMID Year Title
26604067 2016 Expression of microtubule associated protein 2 and synaptophysin in endometrium: high levels in deep infiltrating endometriosis lesions.
26204769 [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].
26022451 2015 Aberrant intermediate filament and synaptophysin expression is a frequent event in malignant melanoma: an immunohistochemical study of 73 cases.
25410733 2014 DHA-PC and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
24927707 2014 Synaptophysin and synaptojanin-1 in Down syndrome are differentially affected by Alzheimer's disease.
23763443 2013 Paucity of synaptophysin-expressing cells in Barrett's mucosa.
23726717 2013 Association between SYP with attention-deficit/hyperactivity disorder in Chinese Han subjects: differences among subtypes and genders.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23292839 2013 Expression of NCAM (CD56), chromogranin A, synaptophysin, c-KIT (CD117) and PDGFRA in normal non-neoplastic skin and basal cell carcinoma: an immunohistochemical study of 66 consecutive cases.
23242284 2013 Synaptic proteins and choline acetyltransferase loss in visual cortex in dementia with Lewy bodies.
More...