Property Summary

NCBI Gene PubMed Count 237
Grant Count 594
R01 Count 381
Funding $79,489,630.7
PubMed Score 3831.97
PubTator Score 850.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 3.003 0.045
osteosarcoma -8.182 0.000
Atopic dermatitis -1.700 0.000
acute myeloid leukemia -1.700 0.030
psoriasis -1.100 0.000

Synonym

Accession P08246 P09649 Q6B0D9 Q6LDP5
Symbols GE
NE
HLE
HNE
ELA2
SCN1
PMN-E

Gene

PANTHER Protein Class (3)

PDB

2Z7F   1B0F   1H1B   1HNE   1PPF   1PPG   2RG3   3Q76   3Q77   4NZL   4WVP   5A09   5A0A   5A0B   5A0C   5A8X   5A8Y   5A8Z   5ABW  

Gene RIF (178)

PMID Text
26567890 Different ELANE mutants show specific activation of different UPR pathways in congenital neutropenia.
26444279 An increased NE: A1 AT ratio is closely associated with liver Inflammation in patients with NASH and could serve as a novel marker to predict NASH in humans
26372354 insights into the PPE and HNE inhibition
26269588 analysis of the mechanistic link between neutrophil elastase expression in atherosclerotic plaques and concomitant pro-inflammatory bioactive IL-1beta secretion from endothelial cells
26221769 Neutrophil elastase activity is deleterious for airway epithelial cell homeostasis.
26193632 Pathogenesis of ELANE-mutant severe neutropenia revealed by induced pluripotent stem cells.
26174650 Paternal Somatic Mosaicism of a Novel Frameshift Mutation in ELANE Causing Severe Congenital Neutropenia.
26018813 Neutrophil elastase was increased in the saliva from COPD patients and additionally distinguished smoking status.
25956321 results suggest that elastase-like proteases in the microglial cells surrounding Abeta plaques are responsible for ApoE degradation in the brain.
25912133 mosaic mutations result in cyclic neutropenia
More...

AA Sequence

MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAH      1 - 70
CVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPA     71 - 140
QGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNG    141 - 210
LIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH                 211 - 267
//

Text Mined References (244)

PMID Year Title
26567890 2016 ELANE mutant-specific activation of different UPR pathways in congenital neutropenia.
26444279 2016 Increased ratio of neutrophil elastase to ?1-antitrypsin is closely associated with liver inflammation in patients with nonalcoholic steatohepatitis.
26372354 2015 Polar Desolvation and Position 226 of Pancreatic and Neutrophil Elastases Are Crucial to their Affinity for the Kunitz-Type Inhibitors ShPI-1 and ShPI-1/K13L.
26269588 2015 Neutrophil elastase promotes interleukin-1? secretion from human coronary endothelium.
26221769 2016 Alpha-1 Antitrypsin Mitigates the Inhibition of Airway Epithelial Cell Repair by Neutrophil Elastase.
26193632 2015 Pathogenesis of ELANE-mutant severe neutropenia revealed by induced pluripotent stem cells.
26174650 2015 Paternal Somatic Mosaicism of a Novel Frameshift Mutation in ELANE Causing Severe Congenital Neutropenia.
26018813 2015 Measurement of C-reactive protein, procalcitonin and neutrophil elastase in saliva of COPD patients and healthy controls: correlation to self-reported wellbeing parameters.
25956321 2015 Monocytic elastase-mediated apolipoprotein-E degradation: Potential involvement of microglial elastase-like proteases in apolipoprotein-E proteolysis in brains with Alzheimers disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...