Property Summary

Ligand Count 974
NCBI Gene PubMed Count 252
PubMed Score 3958.36
PubTator Score 850.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Acute Lung Injury 22
Disease Target Count P-value
osteosarcoma 7950 3.5e-13
psoriasis 6694 1.5e-08
Atopic dermatitis 952 3.6e-04
acute myeloid leukemia 783 3.0e-02
Waldenstrons macroglobulinemia 765 4.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.700 3.0e-02
Atopic dermatitis -1.700 3.6e-04
osteosarcoma -8.182 3.5e-13
psoriasis -1.100 1.5e-08
Waldenstrons macroglobulinemia 3.003 4.5e-02

Gene RIF (192)

AA Sequence

MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAH      1 - 70
CVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPA     71 - 140
QGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNG    141 - 210
LIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH                 211 - 267
//

Text Mined References (259)

PMID Year Title