Property Summary

NCBI Gene PubMed Count 49
Grant Count 45
R01 Count 27
Funding $7,757,947.44
PubMed Score 231.73
PubTator Score 89.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (29)

PMID Text
24913732 Data shows that high ASNS expression in NK/T cell lymphoma is correlated with worse clinicopathological features.
24907114 Polymorphisms of ASNS are associated with an increased risk of asparaginase-related complications in children with acute lymphoblastic leukemia.
24729124 ASNS deficiency is correlated with poor therapeutic response and worse survivals in patients with rectal cancer receiving neoadjuvant CCRT
24398846 cell differentiation was enhanced when asparagine in the culture media was depleted by an addition of L-asparaginase, indicating that downregulation of asparagine synthetase gene expression
24268318 A conditional interaction between the ASNS polymorphism and an early response to chemotherapy among pediatric patients with acute lymphoblastic leukemia.
24139043 study indicates that asparagine synthesis is essential for the development and function of the brain.
23956056 ASNS and MMP19, along with eIF3a, are the sensitivity factors for cisplatin treatment and may serve as potential candidate molecular markers for predicting cisplatin sensitivity of advanced nasopharyngeal carcinoma.
23764751 expression of ASNS was higher in hepatocellular carcinoma tissues; expression of ASNS is an independent factor affecting the survival of HCC patients, and low ASNS expression in HCC was correlated with worse surgical outcomes
23403946 Identifying the roles of ASNS in fetal development, tissue differentiation, and tumor growth may reveal that ASNS function extends beyond asparagine biosynthesis.
22978410 Activation of asparagine synthetase by amino acid limitation results in dynamic changes in genomic histone association.
More...

AA Sequence

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL      1 - 70
WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY     71 - 140
GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV    141 - 210
PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ    211 - 280
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK    281 - 350
YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF    351 - 420
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE    421 - 490
HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK    491 - 560
A//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24913732 2014 Asparagine synthetase expression and its potential prognostic value in patients with NK/T cell lymphoma.
24907114 2015 Polymorphisms of asparaginase pathway and asparaginase-related complications in children with acute lymphoblastic leukemia.
24729124 2014 Deficiency in asparagine synthetase expression in rectal cancers receiving concurrent chemoradiotherapy: negative prognostic impact and therapeutic relevance.
24398846 2014 Analysis of gene profiles involved in the enhancement of all-trans retinoic acid-induced HL-60 cell differentiation by sesquiterpene lactones identifies asparagine synthetase as a novel target for differentiation-inducing therapy.
24268318 2014 Asparagine synthetase (ASNS) gene polymorphism is associated with the outcome of childhood acute lymphoblastic leukemia by affecting early response to treatment.
24139043 2013 Deficiency of asparagine synthetase causes congenital microcephaly and a progressive form of encephalopathy.
23956056 2013 Overexpression of asparagine synthetase and matrix metalloproteinase 19 confers cisplatin sensitivity in nasopharyngeal carcinoma cells.
23764751 2013 Asparagine synthetase is an independent predictor of surgical survival and a potential therapeutic target in hepatocellular carcinoma.
23403946 2013 Asparagine synthetase: regulation by cell stress and involvement in tumor biology.
More...