Property Summary

Ligand Count 3
NCBI Gene PubMed Count 53
PubMed Score 244.35
PubTator Score 89.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.521 1.0e-04
astrocytic glioma -1.100 3.9e-02
Astrocytoma, Pilocytic -1.200 9.8e-05
atypical teratoid / rhabdoid tumor -1.100 7.5e-03
colon cancer 2.800 3.7e-02
cystic fibrosis -2.018 2.9e-04
dermatomyositis 1.200 3.5e-02
ependymoma -1.600 3.4e-02
esophageal adenocarcinoma 1.200 2.4e-02
glioblastoma -1.200 8.4e-04
intraductal papillary-mucinous adenoma (... -1.100 4.7e-02
juvenile dermatomyositis 2.331 8.9e-12
lung cancer 1.500 6.7e-03
lung carcinoma 1.600 1.7e-17
malignant mesothelioma 2.100 2.4e-07
Multiple myeloma 1.576 8.0e-03
MYELODYSPLASTIC SYNDROME -1.300 3.3e-02
nasopharyngeal carcinoma 1.400 1.3e-05
non-small cell lung cancer 1.784 4.3e-17
ovarian cancer 2.400 2.1e-05
pancreatic cancer -3.100 3.0e-05
pancreatic ductal adenocarcinoma liver m... 1.274 2.0e-02
Pick disease -2.100 3.5e-04
Polycystic ovary syndrome -1.906 3.7e-02

 GWAS Trait (1)

Gene RIF (33)

AA Sequence

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL      1 - 70
WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY     71 - 140
GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV    141 - 210
PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ    211 - 280
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK    281 - 350
YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF    351 - 420
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE    421 - 490
HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK    491 - 560
A//

Text Mined References (57)

PMID Year Title