Property Summary

NCBI Gene PubMed Count 10
PubMed Score 92.04
PubTator Score 28.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.600 4.1e-03
Gaucher disease type 1 -1.500 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.600 2.2e-03
osteosarcoma 1.803 6.1e-05
ovarian cancer -1.200 4.4e-05
pancreatic cancer -1.100 8.1e-04
pancreatic ductal adenocarcinoma liver m... -1.413 5.5e-04

AA Sequence

MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDNQFELVFVVGF      1 - 70
QKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFE     71 - 140
DSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAEKSGLPVGPENGVELSKEELI    141 - 210
RRKREEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINL    211 - 280
IRGTGSGGQLQDLDCSSSDDEGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLI    281 - 350
AKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYV    351 - 420
VTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLF    421 - 490
EKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAV    491 - 560
DQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKA    561 - 630
VVAALMKA                                                                  631 - 638
//

Text Mined References (22)

PMID Year Title