Property Summary

NCBI Gene PubMed Count 137
PubMed Score 162.44
PubTator Score 152.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
HIV Infections 100
Prostatic Neoplasms 471
Disease Target Count P-value
lung adenocarcinoma 2714 1.11077812168594E-9
non-small cell lung cancer 2798 1.79345904129119E-6
acute quadriplegic myopathy 1157 3.07349193686435E-5
osteosarcoma 7933 3.3832962021676E-5
Multiple myeloma 1328 3.85627595028585E-5
ovarian cancer 8492 1.22328937453673E-4
lung cancer 4473 3.02304296903936E-4
pancreatic cancer 2300 0.00106437429561792
pancreatic carcinoma 567 0.00106437429561794
interstitial cystitis 2299 0.0014288211154143
oligodendroglioma 2849 0.00202198914474001
gastric cancer 436 0.00205704686050148
invasive ductal carcinoma 2950 0.0034710017470644
adult high grade glioma 2148 0.0142564300744767
ependymoma 2514 0.014532477825066
Breast cancer 3099 0.0250850779809415
Waldenstrons macroglobulinemia 765 0.0269881716487505
subependymal giant cell astrocytoma 2287 0.0280768006920093
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0285701642760793
interstitial lung disease 292 0.0329144748765098
medulloblastoma, large-cell 6234 0.0413187175051975
Disease Target Count Z-score Confidence
Cancer 2346 3.645 1.8
Autosomal dominant nonsyndromic deafness 5 3.4 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer -1.800 0.002
pancreatic cancer -2.000 0.001
interstitial lung disease -1.300 0.033
Waldenstrons macroglobulinemia 1.147 0.027
Multiple myeloma 2.327 0.000
ependymoma 1.200 0.015
oligodendroglioma 1.700 0.002
osteosarcoma 2.430 0.000
medulloblastoma, large-cell 1.300 0.041
acute quadriplegic myopathy 1.040 0.000
non-small cell lung cancer 1.528 0.000
intraductal papillary-mucinous neoplasm ... -1.600 0.029
lung cancer 1.400 0.000
Breast cancer 2.600 0.025
interstitial cystitis -1.200 0.001
adult high grade glioma -1.900 0.014
pancreatic carcinoma -2.000 0.001
subependymal giant cell astrocytoma -3.502 0.028
invasive ductal carcinoma -1.179 0.003
lung adenocarcinoma 1.878 0.000
ovarian cancer -2.500 0.000

Synonym

Accession P08238 B2R5P0 Q5T9W7 Q9NQW0 Q9NTK6 HSP 90
Symbols HSP84
HSPC2
HSPCB
D6S182
HSP90B

Gene

PANTHER Protein Class (2)

PDB

3FWV   1QZ2   5FWK   5FWL   5FWM   1UYM   2L6J   3NMQ   3PRY   3UQ3  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (61)

PMID Text
26651243 We revealed that Hsp90A and Hsp90B are partly colocalized with heparan sulfate proteoglycans (HSPGs) on the cell surface and that this colocalization was sensitive to heparin.
26511315 Apart from these distinct Cdc37/Hsp90 interfaces, binding of the B-Raf protein kinase to the cochaperone is conserved between mammals and nematodes.
26358502 HSP90AB1: Helping the good and the bad
26134567 These results suggest a means by which the hsp90beta interaction could prevent apo-sGCbeta1 from associating with its partner sGCalpha1 subunit while enabling structural changes to assist heme insertion into the H-NOX domain.
26044951 This study identifies overexpression of HSP90 (especially isoform HSP90AB1) and its clients ATR, ATM, and NBS1 as promising markers for radioresistant, aggressive soft tissue sarcomas with particularly poor prognosis.
25995454 Casein kinase 2-mediated phosphorylation of Hsp90beta and stabilization of PXR is a key mechanism in the regulation of MDR1 expression.
25486457 These results suggest that differences in the middle domain of Hsp90alpha and Hsp90beta may be responsible for the isoform-specific interactions with selected proteins.
25300907 The expression levels of Hsp90-beta and annexin A1 positively correlated and such co-overexpression of Hsp90-beta and annexin A1 contributed to lung cancer diagnosis.
25191796 The proteins (HSP90b, TMS1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases.
24880080 A novel mechanism for human carcinogenesis via methylation of HSP90AB1 by SMYD2.
More...

AA Sequence

MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKE      1 - 70
LKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA     71 - 140
EKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIG    141 - 210
YPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQE    211 - 280
ELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK    281 - 350
NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA    351 - 420
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGES    421 - 490
KEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKF    491 - 560
ENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINP    561 - 630
DHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP    631 - 700
NAAVPDEIPPLEGDEDASRMEEVD                                                  701 - 724
//

Text Mined References (160)

PMID Year Title
26651243 2015 Cell surface heparan sulfate proteoglycans are involved in the binding of Hsp90? and Hsp90? to the cell plasma membrane.
26593036 2015 The activity of protein phosphatase 5 towards native clients is modulated by the middle- and C-terminal domains of Hsp90.
26511315 2015 Hsp90·Cdc37 Complexes with Protein Kinases Form Cooperatively with Multiple Distinct Interaction Sites.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26358502 2016 HSP90AB1: Helping the good and the bad.
26134567 2015 Heat Shock Protein 90 Associates with the Per-Arnt-Sim Domain of Heme-free Soluble Guanylate Cyclase: IMplications for Enzyme Maturation.
26044951 2015 HSP90 inhibition as a means of radiosensitizing resistant, aggressive soft tissue sarcomas.
25995454 2015 Casein Kinase 2 (CK2)-mediated Phosphorylation of Hsp90? as a Novel Mechanism of Rifampin-induced MDR1 Expression.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
More...