Property Summary

Ligand Count 335
NCBI Gene PubMed Count 165
PubMed Score 173.49
PubTator Score 152.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.040 3.1e-05
adult high grade glioma -1.900 1.4e-02
Breast cancer 2.600 2.5e-02
ependymoma 1.200 1.5e-02
gastric cancer -1.800 2.1e-03
interstitial cystitis -1.200 1.4e-03
interstitial lung disease -1.300 3.3e-02
intraductal papillary-mucinous neoplasm ... -1.600 2.9e-02
invasive ductal carcinoma -1.179 3.5e-03
lung adenocarcinoma 1.878 1.1e-09
lung cancer 1.400 3.0e-04
medulloblastoma, large-cell 1.300 4.1e-02
Multiple myeloma 2.111 7.7e-05
non-small cell lung cancer 1.528 1.8e-06
oligodendroglioma 1.700 2.0e-03
osteosarcoma 2.430 3.4e-05
ovarian cancer -2.300 1.5e-05
pancreatic cancer -2.000 1.1e-03
pancreatic carcinoma -2.000 1.1e-03
subependymal giant cell astrocytoma -3.502 2.8e-02
Waldenstrons macroglobulinemia 1.147 2.7e-02

Gene RIF (67)

AA Sequence

MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKE      1 - 70
LKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA     71 - 140
EKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIG    141 - 210
YPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQE    211 - 280
ELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK    281 - 350
NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA    351 - 420
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGES    421 - 490
KEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKF    491 - 560
ENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINP    561 - 630
DHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP    631 - 700
NAAVPDEIPPLEGDEDASRMEEVD                                                  701 - 724
//

Text Mined References (191)

PMID Year Title