Property Summary

NCBI Gene PubMed Count 58
PubMed Score 308.03
PubTator Score 131.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.100 1.2e-02
group 3 medulloblastoma -1.400 3.4e-03
lung cancer -1.700 2.5e-04
malignant mesothelioma -1.900 1.3e-07
Multiple myeloma 1.104 8.3e-03
ovarian cancer -2.100 1.2e-06
pancreatic cancer 1.100 7.3e-03
primary pancreatic ductal adenocarcinoma 1.098 1.7e-02

Gene RIF (18)

AA Sequence

MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATW      1 - 70
ESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQ     71 - 140
KAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGR    141 - 210
HCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIK    211 - 280
NLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLME    281 - 350
CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR    351 - 420
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNI    421 - 490
QGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSA    491 - 560
AGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEK    561 - 630
CNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRI    631 - 700
FANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHI    701 - 770
TRKRSGEAAV                                                                771 - 780
//

Text Mined References (64)

PMID Year Title