Property Summary

NCBI Gene PubMed Count 57
Grant Count 187
R01 Count 136
Funding $40,954,091.58
PubMed Score 1119.92
PubTator Score 234.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.486 0.002
esophageal adenocarcinoma 1.100 0.019
glioblastoma 1.800 0.001
osteosarcoma -2.026 0.000
astrocytoma 1.600 0.017
Duchenne muscular dystrophy 1.009 0.000
juvenile dermatomyositis 1.059 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.002
pediatric high grade glioma 1.100 0.003
group 3 medulloblastoma 1.500 0.001
ovarian cancer 1.900 0.002
dermatomyositis 1.100 0.004

Synonym

Accession P08236 B4E1F6 E9PCV0 Q549U0 Q96CL9
Symbols BG
MPS7

Gene

PANTHER Protein Class (2)

PDB

1BHG   3HN3  

Gene RIF (15)

PMID Text
26648021 Selective and amplified bG expression together with the prodrug DOXGA3 had an increased antitumor effect, showing great potential for prostate cancer therapy.
26415878 the use of in silico approaches provided a useful understanding of the effect of single point mutations on the structure-function relationship of GUSBp
24343103 the efficacy of a helper-dependent (HD) canine adenovirus (CAV-2) vector harboring a human GUSB expression cassette (HD-RIGIE) in the MPS VII dog brain was tested
24195516 expression of CES2, UGTA1A1, and GUSB varies in colorectal pathology tissues and that the expression of CES2 is somewhat related to tumor staging.
24033810 This assessment demonstrated that although butyrate dramatically increased beta-glucuronidase production in bioreactors, it adversely impacted the mannose-6-phosphorylation of this lysosomal storage diseasestherapeutic enzyme
22525089 GUSB and ATP2B4 have been validated as a reliable gene combination for Cystic Fibrosis Transmembrane Conductance Regulator gene qPCR data normalization.
21073651 Liver disease affects the expression of common HKGs; beta-glucuronidase and splicing factor arginine/serine-rich 4 are the most stable HKGs for studies of gene expression in HCV-infected human liver.
19224584 Study summarized information on the 49 unique, disease-causing mutations determined so far in the GUS gene.
18591914 The genes GUS and PMM1 are recommended for normalization purposes in gene expression studies of liver tissue from patients with chronic hepatitis.
16272959 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWE      1 - 70
SGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVVLRIGSAHSYAIVWVNGVDTL     71 - 140
EHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFN    141 - 210
YAGLQRSVLLYTTPTTYIDDITVTTSVEQDSGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQL    211 - 280
KVPGVSLWWPYLMHERPAYLYSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNK    281 - 350
HEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN    351 - 420
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVTFVSNSNYAAD    421 - 490
KGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGAETIAGFHQDPPLMFTEE    491 - 560
YQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTRVLGNKKGIFTRQRQPKSAAFLLRERYWKIA    561 - 630
NETRYPHSVAKSQCLENSLFT                                                     631 - 651
//

Text Mined References (69)

PMID Year Title
26648021 2016 Selective and augmented ?-glucuronidase expression combined with DOX-GA3 application elicits the potent suppression of prostate cancer.
26415878 2016 Large scale analysis of the mutational landscape in ?-glucuronidase: A major player of mucopolysaccharidosis type VII.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24343103 2014 Corrective GUSB transfer to the canine mucopolysaccharidosis VII brain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24195516 2014 Relationship between the expression of CES2, UGT1A1, and GUSB in colorectal cancer tissues and aberrant methylation.
24033810 Evaluation of butyrate-induced production of a mannose-6-phosphorylated therapeutic enzyme using parallel bioreactors.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...