Property Summary

NCBI Gene PubMed Count 198
Grant Count 334
R01 Count 196
Funding $38,559,292.25
PubMed Score 841.91
PubTator Score 287.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Hypertension 287 5.701 2.9
Conn's syndrome 22 5.577 2.8
Hyperaldosteronism 27 5.508 2.8
Kidney disease 396 5.001 2.5
Hypokalemia 40 4.49 2.2
Heart disease 279 3.831 1.9
diabetes mellitus 1,663 3.511 1.8
Metabolic syndrome X 155 3.319 1.7
Myocardial Infarction 126 3.261 1.6
Obesity 616 3.226 1.6
Adenoma 165 3.046 1.5
Acne vulgaris 16
Acquired metabolic disease 267 1.0
Adrenogenital disorder 6
Aldosteronism 1
Ascites 2
Atrophic vaginitis 14
Atrophic vulva 6
Breast cancer 3,094
Cardiomyopathy, Dilated 47
Chronic Heart Failure Following Myocardi... 1 
Chronic heart failure 46
Common variable immunodeficiency 72
Contraception 15
Corneal disease 32 2.0
Diagnostic Test for Primary Aldosteronis... 1 
Edema 38
Edema due to Hepatic Cirrhosis 3
Edema due to Nephrotic Syndrome 2
Endometriosis 535
Heart failure 80
Hypertension, Early-Onset, Autosomal Dom... 1 
Hypertensive disorder 58
Hypokalemia Prevention 6
Menopausal flushing 17
Peripheral Edema due to Chronic Heart Fa... 10 
Premenstrual dysphoric disorder 8
Primary adrenocortical insufficiency 6
Pseudohypoaldosteronism 22
Pseudohypoaldosteronism, Type I, Autosom... 1 
Pulmonary Edema due to Chronic Heart Fai... 6 
Ventricular Dysfunction, Left 15
aldosterone-producing adenoma 664
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
chronic rhinosinusitis 512
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
ovarian cancer 8,484
pediatric high grade glioma 2,712
primitive neuroectodermal tumor 3,031
psoriasis 6,685
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (24)

Disease log2 FC p
urothelial carcinoma -1.400 0.023
malignant mesothelioma -2.000 0.000
psoriasis -2.100 0.000
glioblastoma -2.800 0.000
medulloblastoma -2.100 0.005
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -4.100 0.000
primitive neuroectodermal tumor -3.200 0.000
non-small cell lung cancer -2.031 0.000
Common variable immunodeficiency -1.063 0.003
intraductal papillary-mucinous adenoma (... 1.300 0.002
lung cancer -4.100 0.000
colon cancer -2.400 0.014
cystic fibrosis -1.600 0.000
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma -2.200 0.000
aldosterone-producing adenoma -1.021 0.015
breast carcinoma -1.800 0.000
Breast cancer -3.500 0.000
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.500 0.014
ulcerative colitis -1.200 0.001
ovarian cancer -2.900 0.000
chronic rhinosinusitis -1.043 0.012

Synonym

Accession P08235 B0ZBF5 B0ZBF7 Q2NKL1 Q96KQ8 Q96KQ9 MR
Symbols MR
MCR
MLR
NR3C2VIT

Gene

PDB

1Y9R   1YA3   2A3I   2AA2   2AA5   2AA6   2AA7   2AAX   2AB2   2ABI   2OAX   3VHU   3VHV   3WFF   3WFG   4PF3   4TNT   4UDA   4UDB   5HCV  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (174)

PMID Text
26907965 Roles of individual amino acids in human mineralocorticoid and glucocorticoid receptors in the transactivation of downstream genes in response to cortisol and aldosterone.
26728178 Data show that aldosterone via the mineralocorticoid receptor (MR) reduces microRNA miR-29b in vivo in murine aorta and in human primary and cultured vascular smooth muscle cells (VSMCs).
26646587 Data show that both mineralcorticoid receptor (MR) and G-protein estrogen receptor (GPER) contribute to the proliferation and migration of breast and endothelial cancer cells by sodium-hydrogen exchanger 1 protein (NHE-1) upon aldosterone exposure.
26446917 Our current findings demonstrate that Arctigenin is an antagonist of MR and effectively decreases the Na/K-ATPase 1 gene expression. Our work provides a hint for the drug discovery against cardiovascular disease
26305553 Among the class II HDACs, HDAC4 interacted with both MR and HDAC3 after aldosterone stimulation. The nuclear translocation of HDAC4 was mediated by protein kinase A (PKA) and protein phosphatases (PP)
26260058 An association between mineralocorticoid receptor gene polymorphisms, rs17484063 and rs2883929, and preterm birth.
26203193 Data indicate that finerenone inhibits mineralocorticoid receptor (MR), steroid receptor coactivator-1 binding at the regulatory sequence.
26136532 This review will focus on recent advances in our knowledge of MR function with an emphasis on these models. [review]
26073023 Findings indicate that CS-3150 is a selective and highly potent mineralocorticoid receptor antagonist with long-lasting oral activity.
26054365 new insights into aldosterone MR-mediated renal signaling
More...

AA Sequence

METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNSTQGSSKEKQEL      1 - 70
LPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQL     71 - 140
VKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAIVKSPIMCHEKSPSVCSPLNMTSSVCSPAGI    141 - 210
NSVSSTTASFGSFPVHSPITQGTPLTCSPNAENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCS    211 - 280
VKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSA    281 - 350
GSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD    351 - 420
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFP    421 - 490
VGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESW    491 - 560
KSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCKVFFKRA    561 - 630
VEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP    631 - 700
PQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLN    701 - 770
RLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM    771 - 840
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKC    841 - 910
PNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLY    911 - 980
FHRK                                                                      981 - 984
//

Text Mined References (203)

PMID Year Title
26907965 2016 Role of Pro-637 and Gln-642 in human glucocorticoid receptors and Ser-843 and Leu-848 in mineralocorticoid receptors in their differential responses to cortisol and aldosterone.
26728178 2016 Activated mineralocorticoid receptor regulates micro-RNA-29b in vascular smooth muscle cells.
26646587 2016 GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells.
26446917 2016 Arctigenin antagonizes mineralocorticoid receptor to inhibit the transcription of Na/K-ATPase.
26305553 2015 Histone Deacetylase 3 and 4 Complex Stimulates the Transcriptional Activity of the Mineralocorticoid Receptor.
26260058 2015 Two novel genetic variants in the mineralocorticoid receptor gene associated with spontaneous preterm birth.
26203193 2015 Finerenone Impedes Aldosterone-dependent Nuclear Import of the Mineralocorticoid Receptor and Prevents Genomic Recruitment of Steroid Receptor Coactivator-1.
26136532 2015 Renal mineralocorticoid receptor and electrolyte homeostasis.
26073023 2015 Pharmacological profile of CS-3150, a novel, highly potent and selective non-steroidal mineralocorticoid receptor antagonist.
26054365 2015 Cistrome of the aldosterone-activated mineralocorticoid receptor in human renal cells.
More...