Property Summary

Ligand Count 161
NCBI Gene PubMed Count 211
PubMed Score 1005.79
PubTator Score 287.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.7
Corneal disease 31 0.0 3.0

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.300 2.1e-02
aldosterone-producing adenoma -1.021 1.5e-02
Astrocytoma, Pilocytic -1.100 4.8e-03
atypical teratoid / rhabdoid tumor -3.600 1.6e-07
Breast cancer -3.500 1.0e-27
breast carcinoma -1.800 5.3e-41
chronic rhinosinusitis -1.043 1.2e-02
colon cancer -2.400 1.4e-02
Common variable immunodeficiency -1.063 3.4e-03
cystic fibrosis -1.400 1.5e-04
ductal carcinoma in situ -1.500 9.9e-04
glioblastoma -1.700 1.1e-03
intraductal papillary-mucinous adenoma (... 1.300 1.9e-03
invasive ductal carcinoma -1.500 1.4e-02
lung adenocarcinoma -1.100 5.0e-12
lung cancer -2.700 6.1e-05
malignant mesothelioma -2.000 2.3e-07
medulloblastoma -1.600 3.3e-03
medulloblastoma, large-cell -4.100 1.4e-06
non-small cell lung cancer -2.031 5.0e-21
ovarian cancer -2.900 2.3e-11
primitive neuroectodermal tumor -3.200 5.0e-05
psoriasis -2.100 1.0e-11
ulcerative colitis -1.200 7.4e-04
urothelial carcinoma -1.400 2.3e-02

Gene RIF (187)

AA Sequence

METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNSTQGSSKEKQEL      1 - 70
LPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQL     71 - 140
VKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAIVKSPIMCHEKSPSVCSPLNMTSSVCSPAGI    141 - 210
NSVSSTTASFGSFPVHSPITQGTPLTCSPNAENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCS    211 - 280
VKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSA    281 - 350
GSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD    351 - 420
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFP    421 - 490
VGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESW    491 - 560
KSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCKVFFKRA    561 - 630
VEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP    631 - 700
PQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLN    701 - 770
RLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM    771 - 840
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKC    841 - 910
PNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLY    911 - 980
FHRK                                                                      981 - 984
//

Text Mined References (216)

PMID Year Title