Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
R01 Count 3
Funding $213,628.8
PubMed Score 2.62
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGGSLIANSWVLT      1 - 70
AAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLA     71 - 140
CLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGQLLVVDYATCSSSGWWGSTVKTNMICAGGDGVIC    141 - 210
TCNGDSGGPLNCQASDGRWEVHGIGSLTSVLGCNYYYKPSIFTRVSNYNDWINSVIANN               211 - 269
//

Text Mined References (9)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16327289 2006 Inactivity of recombinant ELA2B provides a new example of evolutionary elastase silencing in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
3646943 1987 Characterization of pancreatic elastase II cDNAs: two elastase II mRNAs are expressed in human pancreas.
3427074 1987 Primary structure of human pancreatic elastase 2 determined by sequence analysis of the cloned mRNA.