Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.82
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGGSLIANSWVLT      1 - 70
AAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLA     71 - 140
CLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGQLLVVDYATCSSSGWWGSTVKTNMICAGGDGVIC    141 - 210
TCNGDSGGPLNCQASDGRWEVHGIGSLTSVLGCNYYYKPSIFTRVSNYNDWINSVIANN               211 - 269
//

Text Mined References (9)

PMID Year Title