Property Summary

NCBI Gene PubMed Count 85
Grant Count 41
R01 Count 7
Funding $6,801,220.86
PubMed Score 1139.35
PubTator Score 834.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (161)

Disease Z-score Confidence
Cushing's syndrome 47 4.239 2.1
Acne vulgaris 16
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 25
Allergic rhinitis 91
Amenorrhea Secondary to Ovarian Dysfunct... 8 
Anemia of chronic renal failure 4
Angioedema 36
Ankylosing spondylitis 138
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma 349
Atopic dermatitis 944
Atrophic vaginitis 14
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 16
Bilateral Anorchia 3
Bilateral orchidectomy 3
Blepharoconjunctivitis 5
Breast cancer 3,094 1.0
Bursitis 10
Cerebral edema 5
Chemotherapy-Induced Hypogonadism 3
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Contraception 15
Corneal abrasion 6
Corneal ulcer 9
Corpus Luteum Insufficiency Syndrome 8
Corticosteroid-Binding Globulin Deficien... 1 
Crohn's disease 304
Cyclitis 6
Dacryocystitis 7
Deficiency of testosterone biosynthesis 3
Delayed Puberty 10
Dermatitis herpetiformis 11
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Dysfunctional uterine bleeding 9
Edema of larynx 5
Endometrial Hyperplasia Prevention 9
Endometrial carcinoma 18
Endometriosis 535
Eosinophilic asthma 5
Epicondylitis 19
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 5
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Herpes zoster keratitis 6
Hodgkin's disease 18
Hormone receptor positive malignant neop... 10 
Humoral hypercalcemia of malignancy 6
Hypogonadotropic hypogonadism 4
Hypopituitarism 36
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spira... 3 
Infective blepharitis 5
Infective otitis externa 4
Infertility Secondary to Progesterone De... 8 
Inflammatory bowel disease 142
Inflammatory dermatosis 38
Inhibition of lactation procedure 3
Iridocyclitis 12
Iritis 9
Itching of ear 3
Juvenile rheumatoid arthritis 104
Keratitis 42
Klinefelter's syndrome, XXY 3
LHRH Deficiency 3
Lichen simplex chronicus 7
Löffler's syndrome 5
Male hypogonadism 3
Malignant otitis externa due to Pseudomo... 4 
Mastoidectomy Cavity Infections 3
Meibomianitis 4
Menopausal flushing 17
Miliary tuberculosis 5
Minor Bacterial Skin Infections 3
Multiple Sclerosis 498
Mycosis fungoides 28
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Otitis externa 9
Pemphigus 18
Plaque psoriasis 14
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Postmenopausal osteoporosis 19
Prevention of Premature Labor 9
Primary Hypogonadism due to Bilateral To... 3 
Primary Hypogonadism due to Orchitis 3
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 24
Proctitis 11
Progressive Diffuse Large B-Cell Lymphom... 4 
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate Epithelial Keratopathy 6
Punctate keratopathy 3
Recurrent herpes simplex labialis 3
Rheumatic heart disease 8
Rheumatoid Arthritis 1,160
Rosacea 18
Scalp psoriasis 6
Seborrheic dermatitis 19
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 9
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Staphylococcus Aureus Otitis Externa 4
Stevens-Johnson syndrome 78
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 38
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Tinea corporis 25
Tinea cruris 12
Tinea pedis 30
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protei... 5 
Transplanted organ rejection 10
Undescended testicle 3
Uveitis 103
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
pancreatic ductal adenocarcinoma liver m... 1,795 
psoriasis 6,685
sarcoidosis 358
systemic lupus erythematosus 156
ulcerative colitis 2,087

Expression

Gene RIF (45)

PMID Text
25636722 The study investigate the half-life of intact and elastase cleaved CBG in the rabbit. The half-lives of intact and cleaved human CBG are 10 h and identical.
25335188 the results suggest that DEX repression of Corticosteroid-binding globulin involves tethering of the glucocorticoid receptor to C/EBPb.
25322275 8 naturally occurring CBG mutants with abnormalities in cortisol-binding affinity, cortisol-binding capacity, production/secretion, sensitivity to proteolytic cleavage of the reactive center loop, or recognition by monoclonal antibodies used for ELISAs were identified
25251318 Human cardiomyocytes express mineralocorticoid receptors, but are mostly free of nuclear glucocorticoid receptors. CBG is expressed in myocardium and in Purkinje fibers. CBG in heart is colocalized with mineralocorticoid receptor.
25198130 SERPINA6-rs1998056 regulated by FOXA/ERalpha might be associated with female HCC risk
25010111 Exome chip and 1000 Genomes imputation analysis of this locus in the CROATIA-Korcula cohort identified missense mutations in SERPINA6 and SERPINA1 that did not account for the effects of common variants
24691024 genetic variation in the SERPINA6 gene may be associated with altered CBG levels during adolescence.
24246737 CBG is coexpressed with hypothalamic neuropeptides.CBG may be involved in control of systemic and central stress response.
23300763 Atomic interactions observed between progesterone and CBG explain the lower affinity of progesterone in comparison to corticosteroids.
22932886 three polymorphisms, -26 C/G, -54 C/T, and -144 G/C located close to the putative hepatic nuclear factor (HNF) 1 binding elements, altered the transactivation effect of HNF1beta
More...

AA Sequence

MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSI      1 - 70
SMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELL     71 - 140
ESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQP    141 - 210
FDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAAL    211 - 280
SRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAV    281 - 350
LQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV                   351 - 405
//

Text Mined References (87)

PMID Year Title
25636722 2015 The half-lives of intact and elastase cleaved human corticosteroid-binding globulin (CBG) are identical in the rabbit.
25335188 2014 Inhibition of corticosteroid-binding globulin gene expression by glucocorticoids involves C/EBP?.
25322275 2015 Naturally occurring mutations of human corticosteroid-binding globulin.
25251318 2015 Expression of corticosteroid-binding globulin CBG in the human heart.
25198130 2014 Integrative genomic analysis identifies that SERPINA6-rs1998056 regulated by FOXA/ER? is associated with female hepatocellular carcinoma.
25010111 2014 Genome wide association identifies common variants at the SERPINA6/SERPINA1 locus influencing plasma cortisol and corticosteroid binding globulin.
24691024 2014 Investigation of genetic variants, birthweight and hypothalamic-pituitary-adrenal axis function suggests a genetic variant in the SERPINA6 gene is associated with corticosteroid binding globulin in the western Australia pregnancy cohort (Raine) study.
24246737 2014 Adrenal steroids in the brain: role of the intrinsic expression of corticosteroid-binding globulin (CBG) in the stress response.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...