Property Summary

NCBI Gene PubMed Count 1,894
PubMed Score 3760.30
PubTator Score 9526.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
Breast cancer 3099 3.69866541406262E-32
non-small cell lung cancer 2798 8.09967408675112E-13
tuberculosis 1563 6.4630306234809E-9
ulcerative colitis 2087 1.21070031547987E-8
ovarian cancer 8492 3.75492366889472E-8
malignant mesothelioma 3163 1.28086718922894E-7
lung cancer 4473 2.55563750290881E-4
medulloblastoma, large-cell 6234 6.97755376845065E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00103794153648068
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00162833237480526
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0025754306903617
active Crohn's disease 918 0.00492261160685265
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0204061189458107
acute myeloid leukemia 785 0.0246855785622424
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 6.15 3.1
Inflammatory bowel disease 142 3.039 1.5
Disease Target Count
Inflammatory bowel disease 13 1

Expression

Synonym

Accession P08183 A8K294 B5AK60 Q12755 Q14812
Symbols CLCS
MDR1
P-GP
PGY1
ABC20
CD243
GP170

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
1326 screening 130 / 0 / 193587 High-throughput multiplex screening for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
1451 screening 18 / 0 / 255 Single point confirmation for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
1689 confirmatory 9 / 0 / 31 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
2833 other 1 / 0 / 14 Chemo Reversal assay in ABCB1-expressing cells for one set of SAR compounds
489002 confirmatory 36 / 0 / 53 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen. Follow-up assay.
504476 other 3 / 0 / 7 Chemo Reversal assay in ABCB1-expressing cells for set2 of SAR compounds
504566 confirmatory 63 / 0 / 4 Dose Response for ABC transporter inhibitors: specifically ABCG2 screen, ABCB1 counter-screen. Follow-up assay on set 2
504569 confirmatory 59 / 0 / 8 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen. Follow-up assay for Set 2

Gene RIF (2086)

PMID Text
27294449 Imatinib resistance was more frequent in patients with TT genotype at 1236 than in those with CT/CC genotypes. For G2677T and C3435T, resistance was higher for TT genotype when compared to GG/GT and CT/CC but it was not statistically significant.
27045516 An upregulation of P-gp was observed when artemisone and dihydroartemisinin were co-incubated with mefloquine and amodiaquine.
26938523 Findings suggest the presence of an interactive network of proteins namely, ERM and CD44 with P-gp, in breast cancer cells. It also indicates that despite the cancer cells displaying similar or higher amounts of P-gp, disruption of this interaction complex leads to the loss of P-gp drug efflux functionality and the cells acquiring multidrug resistance phenotype.
26895184 Shortening of the ABCB1 3'-UTR causes loss of miRNA-dependent translational control leading to elevated ABCB1 protein levels.
26857783 ABCB1- 3435C>T polymorphism was not associated with irinotecan induced severe toxicities
26857559 The combination of MTHFR, DRD3 and MDR1 polymorphisms associated with a slow ATV metabolizer phenotype
26838221 Genetic polymorphisms of MDR1 C3435T and G2677A/T, but not C1236T, are associated with increased risk of breast cancer.
26829120 nuclear MRP1 is highly associated with better prognosis of human mucoepidermoid carcinoma.
26823873 ABCB1 polymorphisms were associated with the risk for osteonecrosis of the femoral head.
26823755 MDR1 gene could be activated via epigenetic mechanisms with demethylation of Line-1 in esophageal squamous cell carcinoma, and enhance tumor progression.
More...

AA Sequence

MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMML      1 - 70
VFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAA     71 - 140
GRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTR    141 - 210
GWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKN    211 - 280
LEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASP    281 - 350
SIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG    351 - 420
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRY    421 - 490
GRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSA    491 - 560
LDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT    561 - 630
AGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRI    631 - 700
MKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITF    701 - 770
FLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI    771 - 840
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSL    841 - 910
TQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSA    911 - 980
VVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDI    981 - 1050
PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEP   1051 - 1120
ILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARAL   1121 - 1190
VRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL   1191 - 1260
LAQKGIYFSMVSVQAGTKRQ                                                     1261 - 1280
//

Text Mined References (1898)

PMID Year Title
27294449 C1236T polymorphism in MDR1 gene correlates with therapeutic response to imatinib mesylate in Indian patients with chronic myeloid leukaemia.
27045516 2016 The Interactions of P-Glycoprotein with Antimalarial Drugs, Including Substrate Affinity, Inhibition and Regulation.
26938523 2016 The Role of CD44 and ERM Proteins in Expression and Functionality of P-glycoprotein in Breast Cancer Cells.
26895184 2016 Length variants of the ABCB1 3'-UTR and loss of miRNA binding sites: possible consequences in regulation and pharmacotherapy resistance.
26857783 2016 Effects of UGT1A1*6, UGT1A1*28, and ABCB1-3435C>T polymorphisms on irinotecan induced toxicity in Chinese cancer patients.
26857559 2016 A pharmacogenetic pilot study reveals MTHFR, DRD3, and MDR1 polymorphisms as biomarker candidates for slow atorvastatin metabolizers.
26838221 2016 Influence of Genotype and Haplotype of MDR1 (C3435T, G2677A/T, C1236T) on the Incidence of Breast Cancer--a Case-Control Study in Jordan.
26829120 2016 Nuclear Multidrug Resistance-Related Protein 1 Is Highly Associated with Better Prognosis of Human Mucoepidermoid Carcinoma through the Suppression of Cell Proliferation, Migration and Invasion.
26823873 2015 ABCB1 polymorphisms associated with osteonecrosis of the femeral head.
26823755 2015 Elevated expression of MDR1 associated with Line-1 hypomethylation in esophageal squamous cell carcinoma.
More...