Property Summary

NCBI Gene PubMed Count 1,894
Grant Count 227
R01 Count 78
Funding $28,628,309.28
PubMed Score 3760.30
PubTator Score 9526.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (85)

Disease Z-score Confidence
Cancer 2,346 6.15 3.1
Epilepsy 346 4.616 2.3
Neutropenia 78 3.683 1.8
Inflammatory bowel disease 142 3.039 1.5
Acute coronary syndrome 37
Acute intermittent porphyria 14
Adverse reaction to drug 54
Agitation associated with Bipolar Mania 5
Agitation associated with Schizophrenia 5
Angina pectoris 21
Arthritis, Experimental 39
Atrial Fibrillation 110
Bipolar affective disorder, current epis... 13 
Bipolar disorder in remission 19
Breast cancer 3,094
COLCHICINE RESISTANCE 1
Carcinoma 2,147 1.0
Carcinoma of female breast 20
Cardioversion of Atrial Fibrillation 9
Chromosomal translocation 2
Colorectal Neoplasms 217
Congenital Heart Defects 37
Depression Treatment Adjunct 5
Diffuse large B-cell lymphoma 41
Disease Progression 125
Disruptive behavior disorder 3
Drug-Induced Liver Injury 118
Escherichia coli Infections 1
Esophageal Neoplasms 67
Gestational trophoblastic neoplasia 14
Hematologic Neoplasms 4
Hodgkin's disease 18
Hypertensive disorder 58
Hypotension, Orthostatic 3
Infantile autism 4
Inflammatory Bowel Disease 13 1
Intractable Hiccups 3
Kaposi's sarcoma 20
Kidney Neoplasm 27
Langerhans cell histiocytosis, dissemina... 10 
Liver Cirrhosis, Experimental 108
Liver carcinoma 217
Malignant tumor of testis 11
Mammary Neoplasms 410
Marijuana Abuse 8
Mental disorders 11
Metastatic Breast Carcinoma 21
Mixed bipolar I disorder 9
Mycosis fungoides 28
Nausea 9
Nausea and vomiting 6
Neoplasm Metastasis 138
Neuroblastoma 78
Neurotoxicity Syndromes 26
Non-Hodgkin's lymphoma 22
Pain, Postoperative 1
Parkinson Disease 102
Paroxysmal supraventricular tachycardia 11
Peripheral Neuropathy 303
Pre-Op Apprehension 10
Precursor Cell Lymphoblastic Leukemia Ly... 42 
Prevention of Paroxysmal Supraventricula... 4 
Prinzmetal angina 6
Psychotic disorder 6
Rheumatoid Arthritis 1,160
Schizophrenia 501
Squamous cell carcinoma of the head and ... 24 
Tetanus Adjunct Treatment 8
Vomiting 9
active Crohn's disease 918
acute myeloid leukemia 780
adrenocortical carcinoma 1,427
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nervous system disorder 53
non-small cell lung cancer 2,798
non-small cell lung carcinoma 413
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P08183 A8K294 B5AK60 Q12755 Q14812
Symbols CLCS
MDR1
P-GP
PGY1
ABC20
CD243
GP170

Gene

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
1326 screening 130 / 0 / 193587 High-throughput multiplex screening for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
1451 screening 18 / 0 / 255 Single point confirmation for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
1689 confirmatory 9 / 0 / 31 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen
2833 other 1 / 0 / 14 Chemo Reversal assay in ABCB1-expressing cells for one set of SAR compounds
489002 confirmatory 36 / 0 / 53 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen. Follow-up assay.
504476 other 3 / 0 / 7 Chemo Reversal assay in ABCB1-expressing cells for set2 of SAR compounds
504566 confirmatory 63 / 0 / 4 Dose Response for ABC transporter inhibitors: specifically ABCG2 screen, ABCB1 counter-screen. Follow-up assay on set 2
504569 confirmatory 59 / 0 / 8 Dose Response for ABC transporter inhibitors: specifically ABCB1 screen, ABCG2 counter-screen. Follow-up assay for Set 2

Gene RIF (2087)

PMID Text
27294449 Imatinib resistance was more frequent in patients with TT genotype at 1236 than in those with CT/CC genotypes. For G2677T and C3435T, resistance was higher for TT genotype when compared to GG/GT and CT/CC but it was not statistically significant.
27045516 An upregulation of P-gp was observed when artemisone and dihydroartemisinin were co-incubated with mefloquine and amodiaquine.
26938523 Findings suggest the presence of an interactive network of proteins namely, ERM and CD44 with P-gp, in breast cancer cells. It also indicates that despite the cancer cells displaying similar or higher amounts of P-gp, disruption of this interaction complex leads to the loss of P-gp drug efflux functionality and the cells acquiring multidrug resistance phenotype.
26895184 Shortening of the ABCB1 3'-UTR causes loss of miRNA-dependent translational control leading to elevated ABCB1 protein levels.
26857783 ABCB1- 3435C>T polymorphism was not associated with irinotecan induced severe toxicities
26857559 The combination of MTHFR, DRD3 and MDR1 polymorphisms associated with a slow ATV metabolizer phenotype
26838221 Genetic polymorphisms of MDR1 C3435T and G2677A/T, but not C1236T, are associated with increased risk of breast cancer.
26829120 nuclear MRP1 is highly associated with better prognosis of human mucoepidermoid carcinoma.
26823873 ABCB1 polymorphisms were associated with the risk for osteonecrosis of the femoral head.
26823755 MDR1 gene could be activated via epigenetic mechanisms with demethylation of Line-1 in esophageal squamous cell carcinoma, and enhance tumor progression.
More...

AA Sequence

MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMML      1 - 70
VFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAA     71 - 140
GRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTR    141 - 210
GWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKN    211 - 280
LEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASP    281 - 350
SIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG    351 - 420
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRY    421 - 490
GRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSA    491 - 560
LDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT    561 - 630
AGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRI    631 - 700
MKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITF    701 - 770
FLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI    771 - 840
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSL    841 - 910
TQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSA    911 - 980
VVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDI    981 - 1050
PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEP   1051 - 1120
ILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARAL   1121 - 1190
VRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL   1191 - 1260
LAQKGIYFSMVSVQAGTKRQ                                                     1261 - 1280
//

Text Mined References (1898)

PMID Year Title
27294449 C1236T polymorphism in MDR1 gene correlates with therapeutic response to imatinib mesylate in Indian patients with chronic myeloid leukaemia.
27045516 2016 The Interactions of P-Glycoprotein with Antimalarial Drugs, Including Substrate Affinity, Inhibition and Regulation.
26938523 2016 The Role of CD44 and ERM Proteins in Expression and Functionality of P-glycoprotein in Breast Cancer Cells.
26895184 2016 Length variants of the ABCB1 3'-UTR and loss of miRNA binding sites: possible consequences in regulation and pharmacotherapy resistance.
26857783 2016 Effects of UGT1A1*6, UGT1A1*28, and ABCB1-3435C>T polymorphisms on irinotecan induced toxicity in Chinese cancer patients.
26857559 2016 A pharmacogenetic pilot study reveals MTHFR, DRD3, and MDR1 polymorphisms as biomarker candidates for slow atorvastatin metabolizers.
26838221 2016 Influence of Genotype and Haplotype of MDR1 (C3435T, G2677A/T, C1236T) on the Incidence of Breast Cancer--a Case-Control Study in Jordan.
26829120 2016 Nuclear Multidrug Resistance-Related Protein 1 Is Highly Associated with Better Prognosis of Human Mucoepidermoid Carcinoma through the Suppression of Cell Proliferation, Migration and Invasion.
26823873 2015 ABCB1 polymorphisms associated with osteonecrosis of the femeral head.
26823755 2015 Elevated expression of MDR1 associated with Line-1 hypomethylation in esophageal squamous cell carcinoma.
More...