Property Summary

NCBI Gene PubMed Count 202
PubMed Score 1115.16
PubTator Score 767.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (32)

Disease log2 FC p
Endometriosis -1.255 2.6e-02
active ulcerative colitis 2.558 2.3e-02
acute quadriplegic myopathy 1.031 1.3e-03
adrenocortical carcinoma -2.196 9.9e-05
adult high grade glioma -1.300 9.7e-03
astrocytic glioma -1.800 1.2e-02
Atopic dermatitis -1.500 1.5e-04
Barrett's esophagus 2.400 2.0e-02
Breast cancer -1.600 8.8e-10
Common variable immunodeficiency -1.254 2.8e-03
dermatomyositis 1.300 4.0e-03
Down syndrome 1.100 2.2e-04
esophageal adenocarcinoma 2.700 1.8e-02
gastric carcinoma 2.900 2.3e-02
group 4 medulloblastoma -1.500 1.2e-03
interstitial cystitis -1.200 9.6e-04
interstitial lung disease -1.100 1.7e-02
intraductal papillary-mucinous adenoma (... 3.000 2.2e-04
intraductal papillary-mucinous carcinoma... 4.200 6.5e-06
intraductal papillary-mucinous neoplasm ... 3.600 9.2e-04
lung adenocarcinoma -1.300 1.0e-04
lung cancer -4.400 9.2e-07
lung carcinoma -2.200 6.0e-42
malignant mesothelioma -1.300 1.3e-06
nasopharyngeal carcinoma -1.700 1.8e-05
non-small cell lung cancer -1.527 5.4e-13
oligodendroglioma -1.800 1.4e-02
ovarian cancer -1.400 1.1e-03
pancreatic cancer 2.200 3.3e-06
primary pancreatic ductal adenocarcinoma 2.326 1.2e-02
spina bifida -1.357 3.3e-02
tuberculosis -1.100 2.5e-05

Protein-protein Interaction (1)

Gene RIF (148)

AA Sequence

MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFV      1 - 70
KIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLS     71 - 140
PKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSS    141 - 210
VQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP    211 - 280
PECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG    281 - 350
TTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT                                           351 - 381
//

Text Mined References (208)

PMID Year Title