Property Summary

NCBI Gene PubMed Count 194
Grant Count 1,121
R01 Count 705
Funding $153,653,059.25
PubMed Score 1054.37
PubTator Score 767.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PDB

5FOA   1H03   1H04   1H2P   1H2Q   1M11   1NWV   1OJV   1OJW   1OJY   1OK1   1OK2   1OK3   1OK9   1UOT   1UPN   2C8I   2QZD   2QZF   2QZH   3IYP   3J24  

Gene RIF (140)

PMID Text
26202380 Over expression of CD55 in brushing samples taken from Barrett's esophagus
26107567 present study suggested that the expressions of CD97 antigen and decay accelerating factor DAF were both upregulated in human cervical squamous cell carcinoma
25954012 CD55 is an essential host factor for P. falciparum invasion. CD55-null erythrocytes were refractory to invasion by all isolates of P. falciparum because parasites failed to attach properly to the erythrocyte surface.
25797618 conclude that CD55 expression is affected by glycemic status in human islets and plays a critical role in maintaining the conserved structure of rafts in pancreatic islets, which is similar to that of the related complement inhibitor CD59
25759385 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
25759385 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
25725314 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25653430 Expression of human decay-accelerating factor on intestinal epithelium of transgenic mice does not facilitate coxsackievirus B3 infection by the enteral route.
25457880 DAF rs10746463 polymorphism effects on the risk of developing gastric cancer in Chinese population.
25392210 Taken together, these results support the current model of coxsackievirus B3-DAF interaction and point to a specific role for viral VP1 T271 and DAF S104 at the virus-DAF interface.
More...

AA Sequence

MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFV      1 - 70
KIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLS     71 - 140
PKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSS    141 - 210
VQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP    211 - 280
PECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG    281 - 350
TTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT                                           351 - 381
//

Text Mined References (199)

PMID Year Title
26207632 2015 Obif, a Transmembrane Protein, Is Required for Bone Mineralization and Spermatogenesis in Mice.
26202380 2016 Overexpression of CD55 from Barrett's esophagus is associated with esophageal adenocarcinoma risk.
26107567 2015 Immunohistochemical Expression and Prognostic Significance of CD97 and its Ligand DAF in Human Cervical Squamous Cell Carcinoma.
25954012 2015 Malaria. A forward genetic screen identifies erythrocyte CD55 as essential for Plasmodium falciparum invasion.
25797618 2015 Complement inhibitor CD55 governs the integrity of membrane rafts in pancreatic beta cells, but plays no role in insulin secretion.
25725314 2015 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25653430 2015 Expression of human decay-accelerating factor on intestinal epithelium of transgenic mice does not facilitate infection by the enteral route.
25457880 2015 The tag SNP rs10746463 in decay-accelerating factor is associated with the susceptibility to gastric cancer.
25392210 2015 Specificity of coxsackievirus B3 interaction with human, but not murine, decay-accelerating factor: replacement of a single residue within short consensus repeat 2 prevents virus attachment.
25026028 2014 Expression of CD55 on red blood cells of ?-thalassemia patients.
More...