Property Summary

Ligand Count 614
NCBI Gene PubMed Count 132
PubMed Score 498.16
PubTator Score 285.74

Knowledge Summary

Patent (6,250)

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 9.0e-19
colon cancer 1478 1.9e-07
medulloblastoma, large-cell 6241 2.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Alcohol dependence 107 4.501 2.3
Disease Target Count Z-score Confidence
Schistosomiasis 35 6.355 3.2
Major Depressive Disorder 301 3.203 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -3.000 1.9e-07
medulloblastoma, large-cell 1.200 2.8e-05
psoriasis -2.300 9.0e-19

Protein-protein Interaction (2)

Gene RIF (106)

AA Sequence

MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADL      1 - 70
IIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMA     71 - 140
GMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHIS    141 - 210
RASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEK    211 - 280
ESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS    281 - 350
GQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT    351 - 420
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR                            421 - 466
//

Text Mined References (136)

PMID Year Title