Property Summary

NCBI Gene PubMed Count 258
Grant Count 627
R01 Count 429
Funding $49,639,425.81
PubMed Score 942.79
PubTator Score 616.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 1.720 0.001
atypical teratoid / rhabdoid tumor 1.200 0.001
sonic hedgehog group medulloblastoma 1.500 0.000
psoriasis -1.100 0.000

Synonym

Accession P08151 D0EUY3 E9PQQ9 F5H6H8 Q8TDN9
Symbols GLI

Gene

PDB

4BLB   4KMD   2GLI  

Gene RIF (229)

PMID Text
26997450 Increased SHH, PTCH, and GLI1 protein correlated positively with tumor grade, tumor depth and lymph node metastasis in Peutz-Jeghers syndrome.
26945969 low expression of PCAF in hepatocellular carcinoma tissues facilitates tumor cells migration and invasion which is achieved via Gli1-driven epithelial-mesenchymal transition phenotypes.
26718507 TRIM16 directly regulated the degradation of Gli1 protein via the ubiquitinproteasome pathway.
26603838 IKK-beta suppresses GLI1 ubiquitination.
26601952 NFATc1binds the GLI1 promoter and represses its transcription.
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26544916 GLI1 may be a biomarker of poor prognosis in rhabdomyosarcoma patients, and could itself be a therapeutic target
26505381 The study demonstrates increased expression of Gli1 and p53 in PDAC, and proves that Gli1 could be apotential biomarker for prognostic judgment.
26465952 Data indicate that regulation of sonic hedgehog (SHh)-GLI family zinc finger 1 (Gli1) signals to migration of pancreatic cancer AsPC-1 Cells through mediating eukaryotic translation initiation factor 5A (EIF5A2) gene expression.
26413813 Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement.
More...

AA Sequence

MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSS      1 - 70
PRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMN     71 - 140
HQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDP    141 - 210
LLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELR    211 - 280
PFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAK    281 - 350
HQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG    351 - 420
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGT    421 - 490
GLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSS    491 - 560
LASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYN    561 - 630
PNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDA    631 - 700
RGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQA    701 - 770
SYPDPTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG    771 - 840
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLW    841 - 910
EGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANR    911 - 980
ASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFV    981 - 1050
AILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA                 1051 - 1106
//

Text Mined References (262)

PMID Year Title
26997450 2016 Aberrant expression of Sonic hedgehog signaling in Peutz-Jeghers syndrome.
26945969 2016 PCAF inhibits hepatocellular carcinoma metastasis by inhibition of epithelial-mesenchymal transition by targeting Gli-1.
26718507 2016 Tripartite motif 16 suppresses breast cancer stem cell properties through regulation of Gli-1 degradation via the ubiquitin-proteasome pathway.
26603838 2016 Active IKK? promotes the stability of GLI1 oncogene in diffuse large B-cell lymphoma.
26601952 2016 Nuclear Factor of Activated T Cells-dependent Down-regulation of the Transcription Factor Glioma-associated Protein 1 (GLI1) Underlies the Growth Inhibitory Properties of Arachidonic Acid.
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26544916 2016 GLI1 expression is an important prognostic factor that contributes to the poor prognosis of rhabdomyosarcoma.
26505381 2015 Gli1 expression in pancreatic ductal adenocarcinoma and its clinical significance.
26465952 2015 Sonic Hedgehog-GLI Family Zinc Finger 1 Signaling Pathway Promotes the Growth and Migration of Pancreatic Cancer Cells by Regulating the Transcription of Eukaryotic Translation Initiation Factor 5A2.
26413813 2015 GLI1 orchestrates CXCR4/CXCR7 signaling to enhance migration and metastasis of breast cancer cells.
More...