Property Summary

NCBI Gene PubMed Count 258
Grant Count 339
R01 Count 213
Funding $25,122,450.11
PubMed Score 1124.99
PubTator Score 711.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -2.085 0.026
adrenocortical carcinoma -1.505 0.000
adult high grade glioma 1.600 0.004
pilocytic astrocytoma 1.700 0.001
sonic hedgehog group medulloblastoma 2.000 0.005
non-inflammatory breast cancer -2.300 0.000

Synonym

Accession P08138 B2R961 B4E096
Symbols CD271
p75NTR
TNFRSF16
p75(NTR)
Gp80-LNGFR

Gene

PDB

2N80   2N83   3EWV   2N97  

Gene RIF (185)

PMID Text
26897248 High p75NTR expression is associated with esophageal cancer.
26700963 Studies indicate that neurotrophin receptor p75(NTR) mediates Huntington's disease-associated synaptic and memory dysfunction.
26646181 RIP2 and RhoGDI bind to p75(NTR) death domain at partially overlapping epitopes with over 100-fold difference in affinity, revealing the mechanism by which RIP2 recruitment displaces RhoGDI upon ligand binding.
26462037 Findings show no association of SNPs in NTRK2 and NGFR genes with completed suicide in Slovenian population.
26408608 The percentage of p75NTR+ peripheral blood mononuclear cells increased in early stages of chronic obstructive pulmonary disease (I-II), while TrKA+ peripheral blood mononuclear cells increased in late stages (III-IV).
26311773 Activation of p75NTR receptor identified that the receptor predominantly assembles as a trimer in brain tissue.
26278479 NGFR Ser205Leu polymorphism modulates the autonomic vagal outflow to the heart, particularly in men.
26122862 there are 15 positive studies among 30 studies regarding BDNF/TRKB/P75NTR polymorphisms antidepressant efficacy in depressed patients--{REVIEW}
26119933 preventing phosphorylation of p75(NTR) by pharmacological inhibition of PKA, or by a mutational strategy, cripples p75(NTR)-mediated glioma invasion resulting in serine phosphorylation within the C-terminal PDZ-binding motif (SPV) of p75(NTR).
26093937 assessment of NF-E2 and NGFR expression may provide additional support in reaching a correct diagnosis in discriminating polycythemia vera from prefibrotic/fibrotic primary myelofibrosis and essential thrombocythemia
More...

AA Sequence

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDS      1 - 70
VTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQD     71 - 140
KQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAP    141 - 210
STQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQ    211 - 280
NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL    281 - 350
LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE    351 - 420
STATSPV                                                                   421 - 427
//

Text Mined References (262)

PMID Year Title
26897248 2016 Detection of circulating tumor cells by p75NTR expression in patients with esophageal cancer.
26700963 2016 p75NTR in Huntington's disease: beyond the basal ganglia.
26646181 2015 Structural basis of death domain signaling in the p75 neurotrophin receptor.
26462037 2015 Investigating the associations between polymorphisms in the NTRK2 and NGFR genes and completed suicide in the Slovenian sample.
26408608 2016 A role for NGF and its receptors TrKA and p75NTR in the progression of COPD.
26311773 2015 Detection of p75NTR Trimers: Implications for Receptor Stoichiometry and Activation.
26278479 2015 Functional Ser205Leu polymorphism of the nerve growth factor receptor (NGFR) gene is associated with vagal autonomic dysregulation in humans.
26268439 2015 p75(NTR)-dependent activation of NF-?B regulates microRNA-503 transcription and pericyte-endothelial crosstalk in diabetes after limb ischaemia.
26122862 2015 BDNF/TRKB/P75NTR polymorphisms and their consequences on antidepressant efficacy in depressed patients.
26119933 2016 Glioma invasion mediated by the p75 neurotrophin receptor (p75(NTR)/CD271) requires regulated interaction with PDLIM1.
More...