Property Summary

Ligand Count 2
NCBI Gene PubMed Count 282
PubMed Score 1162.14
PubTator Score 711.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.505 1.4e-10
adult high grade glioma 1.600 3.8e-03
Astrocytoma, Pilocytic 1.700 5.6e-04
Breast cancer -1.400 3.8e-37
osteosarcoma -2.085 2.6e-02
psoriasis -2.100 4.8e-04
sonic hedgehog group medulloblastoma 2.000 4.8e-03

Protein-protein Interaction (1)

Gene RIF (207)

AA Sequence

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDS      1 - 70
VTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQD     71 - 140
KQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAP    141 - 210
STQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQ    211 - 280
NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL    281 - 350
LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE    351 - 420
STATSPV                                                                   421 - 427
//

Text Mined References (287)

PMID Year Title