Property Summary

NCBI Gene PubMed Count 140
PubMed Score 216.37
PubTator Score 233.66

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 1.8e-17
Astrocytoma, Pilocytic 1.800 5.7e-10
Chronic Lymphocytic Leukemia 1.039 1.8e-02
ependymoma 1.100 2.5e-09
glioblastoma 1.300 4.1e-06
group 4 medulloblastoma -1.400 1.7e-05
lung cancer -1.100 4.4e-03
malignant mesothelioma -1.600 1.0e-06
medulloblastoma, large-cell -1.300 3.8e-03
osteosarcoma 2.023 8.0e-05
ovarian cancer 2.100 7.9e-07
pediatric high grade glioma 1.700 4.0e-08
subependymal giant cell astrocytoma 1.294 3.8e-02

Gene RIF (109)

AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR     71 - 140
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL                     141 - 193
//

Text Mined References (143)

PMID Year Title