Property Summary

NCBI Gene PubMed Count 129
Grant Count 65
R01 Count 32
Funding $3,333,437.22
PubMed Score 204.90
PubTator Score 233.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.039 0.018
malignant mesothelioma -1.600 0.000
astrocytoma 1.200 0.000
glioblastoma 1.700 0.000
osteosarcoma 2.023 0.000
posterior fossa group A ependymoma 1.200 0.000
medulloblastoma, large-cell -1.300 0.004
lung cancer -1.100 0.004
pediatric high grade glioma 1.700 0.000
group 4 medulloblastoma -1.400 0.000
pilocytic astrocytoma 1.800 0.000
subependymal giant cell astrocytoma 1.294 0.038
ovarian cancer 2.100 0.000

Synonym

Accession P08134 B3KSW1 Q6ICN3
Symbols H9
ARH9
ARHC
RHOH9

Gene

PDB

1Z2C   2GCN   2GCO   2GCP  

Gene RIF (99)

PMID Text
26741994 The knockdown of RhoC protein decreased the proliferation rate of the parental and the IE1-expressing glioblastoma cells.
26260613 we demonstrated that the inactivation of the RHOC/AKT/MAPK pathway was involved in the tumor-suppressive functions of HOXD10 in cholangiocellular carcinoma .
26020100 Smart particles encapsulating the scrambled siRNA sequence did not affect RhoC protein expression.
25933027 Inhibition of ovarian epithelial carcinoma tumorigenesis and progression by miR106b proceeds through the RhoC pathway.
25677806 Depletion of the kinases ROCK1 and ROCK2, two known RhoC downstream effectors, similarly decreases cancer interaction with ECs
25659578 miR-509 has a critical role in brain metastasis of breast cancer by modulating the RhoC-TNF-alpha network.
25649143 MiR-93-5P may inhibit EOC tumorigenesis and progression by targeting RhoC.
25624724 RhoC protein may upregulate VEGF expression, thereby promoting tumor angiogenesis in esophageal squamous cell carcinoma.
25622907 This is the first report in HNSCC demonstrating the role RhoC plays in mediating EGF-stimulated migration and invasion by down-regulating the PI3K-Akt pathway and E-cadherin expression.
25516960 Results identify RhoC as a prominent binding partner of RhoGDI2 and show that RhoGDI2 modulates RhoC activity in cells promoting lung colonization of bladder cancer cells.
More...

AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR     71 - 140
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL                     141 - 193
//

Text Mined References (132)

PMID Year Title
26741994 2016 The Role of RhoA, RhoB and RhoC GTPases in Cell Morphology, Proliferation and Migration in Human Cytomegalovirus (HCMV) Infected Glioblastoma Cells.
26260613 2015 HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.
26020100 2015 "Smart" Nanoparticles Enhance the Cytoplasmic Delivery of Anti-RhoC Silencing RNA and Inhibit the Migration and Invasion of Aggressive Breast Cancer Cells.
25933027 2015 Inhibition of Ovarian Epithelial Carcinoma Tumorigenesis and Progression by microRNA 106b Mediated through the RhoC Pathway.
25677806 2015 RhoC and ROCKs regulate cancer cell interactions with endothelial cells.
25659578 2015 miR-509 suppresses brain metastasis of breast cancer cells by modulating RhoC and TNF-?.
25649143 2015 RhoC is a major target of microRNA-93-5P in epithelial ovarian carcinoma tumorigenesis and progression.
25624724 2015 RhoC, vascular endothelial growth factor and microvascular density in esophageal squamous cell carcinoma.
25622907 2015 RhoC mediates epidermal growth factor-stimulated migration and invasion in head and neck squamous cell carcinoma.
25516960 2015 RhoC Is an Unexpected Target of RhoGDI2 in Prevention of Lung Colonization of Bladder Cancer.
More...