Property Summary

NCBI Gene PubMed Count 69
Grant Count 18
R01 Count 12
Funding $2,130,302.14
PubMed Score 293.36
PubTator Score 209.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.100 0.002
osteosarcoma -1.496 0.000
periodontitis 1.100 0.000
primitive neuroectodermal tumor -1.400 0.009
tuberculosis 2.100 0.000
primary pancreatic ductal adenocarcinoma 1.136 0.002
intraductal papillary-mucinous carcinoma... -1.200 0.005
intraductal papillary-mucinous neoplasm ... -1.600 0.001
lung cancer -1.500 0.000
cystic fibrosis 1.400 0.003
group 4 medulloblastoma -1.300 0.008
ulcerative colitis 1.600 0.001
ovarian cancer 1.500 0.001
dermatomyositis -1.200 0.000

Gene RIF (37)

PMID Text
26578516 Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1.
26202167 ANXA6 was detected as a novel systemic lupus erythematosus susceptibility gene, with several single-nucleotide polymorphisms (SNPs) contributing independently to the association with disease
25947258 ANXA6 is a EZH2 target gene involving gastric cellular proliferation.
25409976 Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains
24354805 The rapid degradation of activated EGFR in AnxA6-depleted invasive tumor cells underlies their sensitivity to EGFR-targeted inhibitors.
24194536 These results show that influenza A virus replication depends on maintenance of the cellular cholesterol balance and identify AnxA6 as a critical factor in linking the virus to cellular cholesterol homeostasis.
23683957 Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers.
23541940 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking and alcohol intake affect risk of psoriasis.
23360953 Ca(2+) is the main factor which regulates the interaction of AnxA6 with monolayers composed of neutral lipids, determine AnxA6 localization in cholesterol and sphingomyelin enriched microdomains, thus contributing to the etiology of the NPC disease.
23341998 anxA6 inhibits Drp1 activity, and Ca(2+)-binding to anxA6 relieves this inhibition to permit Drp1-mediated mitochondrial fission
More...

AA Sequence

MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL      1 - 70
IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER     71 - 140
DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH    141 - 210
LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS    211 - 280
RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR    281 - 350
VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE    351 - 420
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS    421 - 490
SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDKTSLETRFMTILCTRSYPHLR    491 - 560
RVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRS    561 - 630
EIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED                               631 - 673
//

Text Mined References (76)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26578516 2016 Annexin A6 and Late Endosomal Cholesterol Modulate Integrin Recycling and Cell Migration.
26202167 2015 Gene-based meta-analysis of genome-wide association study data identifies independent single-nucleotide polymorphisms in ANXA6 as being associated with systemic lupus erythematosus in Asian populations.
25947258 2015 Genome-wide transcriptional profiling analysis reveals annexin A6 as a novel EZH2 target gene involving gastric cellular proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25409976 2015 Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains.
24354805 2013 Reduced annexin A6 expression promotes the degradation of activated epidermal growth factor receptor and sensitizes invasive breast cancer cells to EGFR-targeted tyrosine kinase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194536 2013 Annexin A6-balanced late endosomal cholesterol controls influenza A replication and propagation.
23683957 2013 Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers.
More...