Property Summary

NCBI Gene PubMed Count 76
PubMed Score 298.75
PubTator Score 209.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.100 2.1e-03
cystic fibrosis 1.400 3.0e-03
dermatomyositis -1.200 4.8e-04
group 4 medulloblastoma -1.300 7.8e-03
intraductal papillary-mucinous carcinoma... -1.200 5.4e-03
intraductal papillary-mucinous neoplasm ... -1.600 8.3e-04
lung cancer -1.100 1.6e-03
osteosarcoma -1.496 1.9e-04
ovarian cancer 1.500 7.4e-04
periodontitis 1.100 9.1e-31
primary pancreatic ductal adenocarcinoma 1.136 1.9e-03
primitive neuroectodermal tumor -1.400 8.7e-03
tuberculosis 2.100 2.3e-08
ulcerative colitis 1.600 1.2e-03

Gene RIF (44)

AA Sequence

MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL      1 - 70
IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER     71 - 140
DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH    141 - 210
LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS    211 - 280
RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR    281 - 350
VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE    351 - 420
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS    421 - 490
SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDKTSLETRFMTILCTRSYPHLR    491 - 560
RVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRS    561 - 630
EIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED                               631 - 673
//

Text Mined References (83)

PMID Year Title