Property Summary

NCBI Gene PubMed Count 90
Grant Count 87
R01 Count 38
Funding $26,152,364.15
PubMed Score 292.13
PubTator Score 626.24

Knowledge Summary

Patent

No data available

Synonym

Accession P08118 B1API6 P11999 Q13125 Q6IAY9 Q9UC59
Symbols MSP
PSP
IGBF
MSPB
PN44
PRPS
HPC13
PSP57
PSP94
PSP-94

Gene

PANTHER Protein Class (2)

PDB

2IZ3   3IX0  

Gene RIF (62)

PMID Text
26939004 decreased expression of MSMB parallels the clinical progression of PC and adjusted serum MSMB levels are associated with PC risk
25261323 Based on nasopharyngeal MSP gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
25188517 PSP94 regulate the Lin28/Let-7 loop in ovarian cancer cells.
24186202 Data indicate that prostate secretory protein PSP94 is decreased in an ovarian cancer drug-resistant cell line, and plays an important role in the development of drug resistance in vitro.
24115268 Beta-microseminoprotein in urine was statistically lower in prostate cancer patients.
24037734 The rs10993994 genotype in the MSMB gene modifies the association between number of sexual partners and prostate cancer risk.
23608167 Han Chinese men carrying the MSMB variant have an increased risk of spermatogenic failure associated with male infertility.
23555189 Two SNPs, in beta-microseminoprotein at and in kallikrein-related peptidase 2 at, are associated with PCA3 score at genome-wide significance level
23375721 Involvement of the hinge region of CRISPs in interaction with PSP94 may affect the domain movement of CRISPs essential for the ion-channel regulatory activity resulting in inhibition of this activity.
22993349 MSMB and CRISP3 were widely distributed in ovaries and in ovarian tumors; the expression of MSMB fits well with a tumor-suppressor function in ovarian carcinogenesis.
More...

AA Sequence

MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC      1 - 70
TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII                               71 - 114
//

Text Mined References (91)

PMID Year Title
26939004 2016 Microseminoprotein-Beta Expression in Different Stages of Prostate Cancer.
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25416956 2014 A proteome-scale map of the human interactome network.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
25188517 2014 PSP94, an upstream signaling mediator of prostasin found highly elevated in ovarian cancer.
24753544 2014 Genetic variation in prostate-specific antigen-detected prostate cancer and the effect of control selection on genetic association studies.
24740154 2014 Genome-wide association scan for variants associated with early-onset prostate cancer.
24186202 2014 PSP94 contributes to chemoresistance and its peptide derivative PCK3145 represses tumor growth in ovarian cancer.
24115268 2014 MALDI MS profiling of post-DRE urine samples highlights the potential of ?-microseminoprotein as a marker for prostatic diseases.
24037734 2013 MSMB gene variant alters the association between prostate cancer and number of sexual partners.
More...